KEGG   Leptospirillum ferriphilum: LFML04_1296Help
Entry
LFML04_1296       CDS       T02319                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lfi  Leptospirillum ferriphilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1228036..1228605
Genome map
AA seq 189 aa AA seqDB search
MTTDPERERKARFLETFLKENPEVDPRLVAAILRLPRRPFFPDSSGKDLYGEFRPCGWGG
RVSPTPREALLILMGSRIRTGERIGVWCLTDPYFLLLLLELTHRVTIVEEDKALRTQLRQ
SIDDLGYAYIPVLTSLEEIETQSAPPERIVRIFDGPVPKQRLGPVRPLRSPVQGWVLDHT
LTGGPIELG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggatcctgaaagagagcggaaagcccgctttctggaaacgtttctcaaggaa
aacccggaagtggatccccgtctggtggcggcgatcctccggttaccgcgaagacctttt
ttcccggactcttcgggaaaagacctttacggggagtttcgcccctgcggatggggaggg
cgagtgtcgccaacaccccgggaagccctcctgatccttatgggatcccgaatccggacc
ggggaaagaattggagtctggtgcctgacggatccctattttctgcttctgctcctggaa
ctcacccatcgggtgacaatcgtggaagaggacaaggctctccgaactcagcttcgccag
tcgatcgacgatctcggatacgcttacattcctgtcctcacatccctggaagagatcgaa
acccagtcggcccctccggagaggatcgtgcgcatttttgatggtcccgtcccgaaacag
aggcttggaccagttcgcccgcttcgatctcctgtccagggatgggttctggatcacaca
ttgacaggaggccccattgaactcgggtga

DBGET integrated database retrieval system