KEGG   Leptospirillum ferriphilum ML-04: LFML04_1296Help
Entry
LFML04_1296       CDS       T02319                                 

Definition
hypothetical protein
Organism
lfi  Leptospirillum ferriphilum ML-04
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1228036..1228605
Genome map
AA seq 189 aa AA seqDB search
MTTDPERERKARFLETFLKENPEVDPRLVAAILRLPRRPFFPDSSGKDLYGEFRPCGWGG
RVSPTPREALLILMGSRIRTGERIGVWCLTDPYFLLLLLELTHRVTIVEEDKALRTQLRQ
SIDDLGYAYIPVLTSLEEIETQSAPPERIVRIFDGPVPKQRLGPVRPLRSPVQGWVLDHT
LTGGPIELG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggatcctgaaagagagcggaaagcccgctttctggaaacgtttctcaaggaa
aacccggaagtggatccccgtctggtggcggcgatcctccggttaccgcgaagacctttt
ttcccggactcttcgggaaaagacctttacggggagtttcgcccctgcggatggggaggg
cgagtgtcgccaacaccccgggaagccctcctgatccttatgggatcccgaatccggacc
ggggaaagaattggagtctggtgcctgacggatccctattttctgcttctgctcctggaa
ctcacccatcgggtgacaatcgtggaagaggacaaggctctccgaactcagcttcgccag
tcgatcgacgatctcggatacgcttacattcctgtcctcacatccctggaagagatcgaa
acccagtcggcccctccggagaggatcgtgcgcatttttgatggtcccgtcccgaaacag
aggcttggaccagttcgcccgcttcgatctcctgtccagggatgggttctggatcacaca
ttgacaggaggccccattgaactcgggtga

DBGET integrated database retrieval system