KEGG   Leptospirillum ferriphilum: LFML04_2085Help
Entry
LFML04_2085       CDS       T02319                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lfi  Leptospirillum ferriphilum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:lfi00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1982413..1982922)
Genome map
AA seq 169 aa AA seqDB search
MEEILGTCGVSLEFWPVQSSDRTAALLSANSPGAEEMEEILSEQDRYFQKLREALGYQTR
DLVVVYPELPGLSAMLDRFRPIHYHEDDEVRYVVDGEGVFGFVLPDGDQVELLVEKGDFI
RVPRLLEHWFRLTETRRIKAIRYFTGTAGWVPVYTGTPSLFSGEAARTA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaattcttggaacatgcggcgtttctctggagttctggcctgtccagtcatcg
gatcggacagcggccctgctttccgcgaactctcccggagcggaagagatggaggaaatt
ctgtcggaacaggaccgctatttccagaagcttcgcgaagcccttggataccagacgcgc
gatctggtggtggtctatccggaactgcccgggctttccgccatgctcgaccgttttcgg
cccattcattaccatgaggatgatgaagtccgttatgtggtcgacggggaaggagttttt
ggttttgttcttcccgacggggaccaggtcgagcttcttgtggaaaaaggggattttatc
cgggttccccgcttgctcgagcactggttccgtctgacggaaacacggaggatcaaggcg
attcgctatttcaccgggacggcaggctgggttcccgtctatacgggaacaccgtctctc
ttttccggggaggcggcccggaccgcctga

DBGET integrated database retrieval system