KEGG   Leptospirillum ferriphilum: LFML04_2087Help
Entry
LFML04_2087       CDS       T02319                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lfi  Leptospirillum ferriphilum
Brite
Enzymes [BR:lfi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LFML04_2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1983780..1984796)
Genome map
AA seq 338 aa AA seqDB search
MKRWAPRRWLLFSLTAVFFLVSSRSEAASLVPLPPAPPVPSNNLMTKDKIALGKKLFFDP
RLSVNGSISCAFCHVPTAGYADPKPVSLGVGGKRGGRNAPPVLNAAYFPLQFWDGRAGSL
EEQALGPLTNPVEMANPNYRSIVMRLRRIREYRIWFMRVYGGPVNIDHVAQAISAFERTL
VTPDSPYDRYMMGDKNALTASQKRGLALFRGKARCVICHNGALLSDFGYHNLGVPQTGPL
RIDVGRYAVTHDVMDKGKFRTPTLRNVALTAPYMHDGSLRTLKDVVEFYDRGGGKSPFVK
DALLVPLHLTPLEKKDLVGFLKSLTGETKTEMSYRASR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatgggccccccgcagatggcttctcttcagtctgacagcagtgtttttcctt
gtttcctcgcgttcggaagcggcgtctctggttcctcttcctccggcaccgccggttccg
tccaacaatctgatgacgaaagacaagattgcccttggaaagaagcttttttttgatccg
cgcctttctgtcaacggatcaatcagttgtgccttttgccacgtcccgacggccgggtat
gcggatccgaagcctgtctccctgggggtcggcggcaaaagaggcggtcgaaatgcccct
cctgtcctgaatgccgcctactttcctcttcagttttgggacgggcgtgcgggcagtctt
gaggagcaggccctgggtccgttgacgaatcccgtggaaatggctaaccccaactatcgt
tccatcgtgatgcgtctccgtcggattcgggagtatcggatctggtttatgcgtgtgtat
ggcggtcctgtcaatattgatcatgtggcacaggccatttcggcgttcgagcggaccctg
gtcaccccggacagtccctatgaccgctacatgatgggagacaaaaacgccctcactgct
tcccagaaacgaggtttggcgctctttcgcggaaaggcaaggtgcgtgatatgccataat
ggggctctgttgagtgatttcgggtaccataatcttggggttccccagacaggacccctt
cgtatcgatgtgggacgatatgccgtaacccacgatgtgatggacaagggcaagttccgg
actccaaccttgaggaacgttgcgctcaccgctccttatatgcatgatggatcactcagg
actctgaaggatgtagttgaattctatgaccggggcggcggaaaatcgccttttgtcaag
gacgccctccttgttcccctgcatctgacgccattggagaaaaaagatctcgtcgggttc
ctgaaatctttgacaggggagacgaagacggaaatgtcctaccgggcgtccagatag

DBGET integrated database retrieval system