KEGG   Leptospirillum ferriphilum: LFML04_2207Help
Entry
LFML04_2207       CDS       T02319                                 

Definition
beta-glucosidase-related glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lfi  Leptospirillum ferriphilum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lfi00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lfi00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2088307..2089335)
Genome map
AA seq 342 aa AA seqDB search
MTSGKHPEPEWGQWLWVSLPGARLGAEDIRWLHQIRPGGVVLFAENGTRAEDVKKLISEI
REALSPQDVWIAIDQEGGRVARLKEGVPRLSPARTLGNGDPSEIFRSAFHLGRALRQTGI
DIDFAPVLDVDSNPDNPVIGDRSFSREPWEVARLSMAFSHGLEAGGVIPCGKHVPGHGDT
LLDSHLALPTVDAPEAILSGREFLPFEKAIADGMPMLMTAHVMYPALDKKWPATLSRKIM
QDMLRKKWDFRGLLLSDDLSMAAVGKPFPFSVVVERALSVTCDGLLVLKSRDKPLEAIRI
IKGLSEKNPGLWRARLEKSIARRAVLGKRIAFCRKAAERLPR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctgggaaacacccggaacccgaatggggacaatggttgtgggtcagccttccc
ggcgctcgcctgggagcggaagacatccgctggttgcatcagatcagacccggcggcgtg
gtgttgtttgccgagaacgggacgcgcgccgaggacgtgaaaaaactgatttccgaaatc
cgggaggctctttccccgcaagacgtctggattgcgatcgatcaggagggaggacgtgtc
gcccgcctgaaagaaggtgtcccccgtctctctcccgccagaaccctggggaatggagac
ccctccgaaattttccggtcggccttccatctcggacgcgcattgcggcagacggggatc
gacatcgatttcgcccccgtactggatgtggactccaatccggacaatccggtgatcggc
gatcgctccttttccagggagccctgggaggtcgcccgtctgtccatggcgttttcgcac
ggactcgaggcgggaggtgtcatcccttgcgggaaacacgttcccggccacggagacact
cttctggactcccacctggcccttccgacggttgatgcgccggaagccatcctttctgga
cgggagtttcttccgttcgaaaaagcgattgcagacgggatgccgatgctgatgacggcg
catgttatgtaccccgccctggacaagaaatggccggccaccctgtcccgaaaaatcatg
caggacatgcttcggaagaagtgggattttcgcggccttcttctgtccgatgatctgtcc
atggccgcggtcggaaagccctttcccttttccgtcgtggtggaaagagccctgtctgtc
acctgcgacggtctcctggtcctcaaatcccgcgacaagccgctggaggcgattcggatc
atcaagggcctgtctgaaaagaatccgggtctctggcgcgctcgtcttgaaaaatcgatc
gcccgccgtgccgtccttggaaaaagaattgccttctgccgcaaggccgccgaaaggctt
ccccgatga

DBGET integrated database retrieval system