KEGG   Leptospirillum ferriphilum ML-04: LFML04_2207Help
Entry
LFML04_2207       CDS       T02319                                 

Definition
beta-glucosidase-related glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LFML04_2207
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    LFML04_2207
Enzymes [BR:lfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LFML04_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2088307..2089335)
Genome map
AA seq 342 aa AA seqDB search
MTSGKHPEPEWGQWLWVSLPGARLGAEDIRWLHQIRPGGVVLFAENGTRAEDVKKLISEI
REALSPQDVWIAIDQEGGRVARLKEGVPRLSPARTLGNGDPSEIFRSAFHLGRALRQTGI
DIDFAPVLDVDSNPDNPVIGDRSFSREPWEVARLSMAFSHGLEAGGVIPCGKHVPGHGDT
LLDSHLALPTVDAPEAILSGREFLPFEKAIADGMPMLMTAHVMYPALDKKWPATLSRKIM
QDMLRKKWDFRGLLLSDDLSMAAVGKPFPFSVVVERALSVTCDGLLVLKSRDKPLEAIRI
IKGLSEKNPGLWRARLEKSIARRAVLGKRIAFCRKAAERLPR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctgggaaacacccggaacccgaatggggacaatggttgtgggtcagccttccc
ggcgctcgcctgggagcggaagacatccgctggttgcatcagatcagacccggcggcgtg
gtgttgtttgccgagaacgggacgcgcgccgaggacgtgaaaaaactgatttccgaaatc
cgggaggctctttccccgcaagacgtctggattgcgatcgatcaggagggaggacgtgtc
gcccgcctgaaagaaggtgtcccccgtctctctcccgccagaaccctggggaatggagac
ccctccgaaattttccggtcggccttccatctcggacgcgcattgcggcagacggggatc
gacatcgatttcgcccccgtactggatgtggactccaatccggacaatccggtgatcggc
gatcgctccttttccagggagccctgggaggtcgcccgtctgtccatggcgttttcgcac
ggactcgaggcgggaggtgtcatcccttgcgggaaacacgttcccggccacggagacact
cttctggactcccacctggcccttccgacggttgatgcgccggaagccatcctttctgga
cgggagtttcttccgttcgaaaaagcgattgcagacgggatgccgatgctgatgacggcg
catgttatgtaccccgccctggacaagaaatggccggccaccctgtcccgaaaaatcatg
caggacatgcttcggaagaagtgggattttcgcggccttcttctgtccgatgatctgtcc
atggccgcggtcggaaagccctttcccttttccgtcgtggtggaaagagccctgtctgtc
acctgcgacggtctcctggtcctcaaatcccgcgacaagccgctggaggcgattcggatc
atcaagggcctgtctgaaaagaatccgggtctctggcgcgctcgtcttgaaaaatcgatc
gcccgccgtgccgtccttggaaaaagaattgccttctgccgcaaggccgccgaaaggctt
ccccgatga

DBGET integrated database retrieval system