KEGG   Leptospirillum ferriphilum ML-04: LFML04_2234Help
Entry
LFML04_2234       CDS       T02319                                 

Definition
UDP-N-acetylglucosamine enolpyruvyl transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LFML04_2234
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LFML04_2234
Enzymes [BR:lfi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LFML04_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2111529..2112857)
Genome map
AA seq 442 aa AA seqDB search
MDRFHIVGGSPLRGEVIVSGSKNSALPILFSALLGGGLEISNIPSLRDIRTAFSLLSQLG
IRADPLVSADPEKTDLTQGIPSHKNDGWPGKYRLLEESIEAHEAPYDLVRTMRASILCLG
PLLARRKRGRVSLPGGCLIGARPVDIHLNAFVRMGAKISIDHGYIDAHTNGLTGCDIHLP
YPTVTGTENIMMAATLARGTTRIFNAAQEPEVSDLAFSLIARGARIEGIGTSSIKITGVD
SLLEAPYTVMSDRIEAGTFLVAGALLGEDLMIRNVDVSCLDSLLGTLRDMGADFQEKNGS
VSISRIRKPRGTSARTEPYPGFPTDMQAQILPLMAIAEGPSTVVETVFENRFTHVMEMNR
MGANIDIHGSRAFVRGGASLEGASVMASDLRASAGLVLAALIAKGESEIQRVYHIDRGYE
KIETKLESIGARIKRVRGEEIS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggatcggtttcatattgtcgggggatctccattacgcggggaggtcattgtttcaggg
tccaaaaactctgcccttcccatccttttttccgctcttcttgggggcggtcttgaaatt
tccaatattccctcccttcgggacatccggacagctttttctctgttgtcccagctgggt
atccgggctgatcctctcgtttcggcggatccggaaaaaacggatctgacccagggcatt
ccttcccacaaaaatgatgggtggccgggaaaatatcggttattggaagaaagcatcgaa
gcgcatgaggcaccttatgatctggtcaggacgatgagggcttctattttgtgcctggga
ccgcttcttgccagacgaaaaaggggcagagtgtctcttccgggtgggtgtctgattggt
gcccgaccggtggacattcatctgaacgcctttgtccggatgggtgcgaagatctcgatc
gatcacggctatattgacgcccatacgaacggcctgaccggatgcgatattcatttgccc
tacccgacggtgaccggaacagaaaatattatgatggccgcgactcttgctcgggggaca
acccggatattcaatgcggcacaggagcccgaagtcagcgatcttgccttttccctgatc
gcccgaggggctcggatcgaagggattggtacatcctcgataaaaattacaggcgtggac
agtcttttagaagccccctataccgtcatgagcgacagaatcgaggcgggaacgtttctt
gttgcgggagcacttctgggagaggatctgatgatccggaatgtggatgtctcctgtctc
gattccttgcttggaaccctgagagatatgggggccgattttcaggagaagaacggctcg
gtttcgatcagccgaatccgaaagccccgcgggacgtccgctcgtacagagccttatccg
ggattcccgacagatatgcaagcacagattcttcctctcatggcgattgcggaaggtcct
tccacagtcgttgagaccgtctttgaaaaccggttcacgcatgtgatggaaatgaatcgt
atgggggccaatatcgatattcatggttccagagcatttgtccggggaggggccagcctc
gaaggggcttccgtcatggcttccgatctgagagcctctgccggacttgttctggcggct
ctgatcgcaaaaggcgaatcggaaatccagcgggtgtatcatatagaccgtggctatgaa
aagatcgaaacgaaactggagagtatcggtgcccggatcaagagggtccgtggggaggag
atatcatag

DBGET integrated database retrieval system