KEGG   Leptospirillum ferriphilum ML-04: LFML04_2272Help
Entry
LFML04_2272       CDS       T02319                                 

Definition
(GenBank) endoglucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
lfi  Leptospirillum ferriphilum ML-04
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2147763..2148863)
Genome map
AA seq 366 aa AA seqDB search
MKPMILGVMIVWFFVWGSGLSRASEFHAVWEHYRACCIQSDGRVIDRGRQSVTTSEGEAY
ALFFALVDNDPLLYSRLLRWTRDNLSRGDLSAHLPAWLWGERKNGQWGVLDQNSATDADL
WISFDLMEAGRLWHRSEYLRLGERLAFLISLRDFANLPGFGAFPLGGERGFHPAGTVWRT
NPSYFPPFLLRFMEHRFGGRPWSGLPGRFLAFVKSVSSCGFVPDWVTYDTGKGWQPDPVT
GPLGSYDAIRVYLWAGMTSVRDPQEQLLLKRLQGWSRKGRSSPTLFVNTKTCSAYGKPPP
GFRAAYLPFLRRENVSSFREEFRRMLSRDPMKNDPGYYDTNLYLFGTGFLEKRFSFDERG
RLHVRW
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaatgatactgggggtgatgatcgtctggttttttgtctggggatccggtctt
tcccgggcgagtgaattccatgcggtctgggaacattatcgcgcgtgctgcatccagtcc
gacggacgggtgattgaccggggtcggcagagcgtcacgaccagcgagggagaagcgtac
gctctcttttttgctcttgtcgacaacgatccgctcctctattcccgacttcttcgctgg
accagggataacctgtcccgcggagatctgtccgcccatcttccggcatggctctggggg
gagagaaagaatggacaatggggcgttctcgatcaaaattcggccacagatgcggacctc
tggatctccttcgatctgatggaagcgggaagactctggcatcggtcggagtatctccgg
ctgggagagcgtctggcgtttttgatctccctccgggattttgcaaatcttccgggattc
ggggctttcccgttggggggagaacggggttttcatccggccgggacggtctggaggaca
aatcccagttatttccctccgtttctgttgcgttttatggagcaccgttttggggggagg
ccatggagcgggcttcccgggcgttttctggcgtttgtgaagtccgtcagttcttgcgga
tttgttccggactgggtcacgtatgacacaggaaaaggatggcaacccgatccggtaacc
ggtcccctggggtcgtatgatgccatccgcgtttatctgtgggcggggatgacgtctgtc
cgggacccgcaggaacagttgcttctgaaaaggcttcagggatggtcacgcaaaggacga
tcttctccgactctctttgtgaatacgaaaacctgctccgcctatggaaagccccctcca
ggattcagggcggcctacctcccttttctgcgacgcgagaacgtgtcttctttccgggaa
gaattccgtcggatgctttcccgtgatccgatgaaaaacgatcccggctattacgatacc
aacttgtatctgttcggaacgggttttctcgaaaaaaggttttcctttgatgaaaggggc
cgactacatgtgcgatggtaa

DBGET integrated database retrieval system