KEGG   Leptospirillum ferriphilum ML-04: LFML04_2423Help
Entry
LFML04_2423       CDS       T02319                                 

Gene name
forB2
Definition
(GenBank) Pyruvate synthase beta subunit/Pyruvate ferredoxin oxidoreductase
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LFML04_2423 (forB2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFML04_2423 (forB2)
   00020 Citrate cycle (TCA cycle)
    LFML04_2423 (forB2)
   00620 Pyruvate metabolism
    LFML04_2423 (forB2)
   00640 Propanoate metabolism
    LFML04_2423 (forB2)
   00650 Butanoate metabolism
    LFML04_2423 (forB2)
  Energy metabolism
   00680 Methane metabolism
    LFML04_2423 (forB2)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LFML04_2423 (forB2)
Enzymes [BR:lfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LFML04_2423 (forB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2301256..2302122)
Genome map
AA seq 288 aa AA seqDB search
MSFDNIKMSPALEKYMTKEYRDLVERGPYGKQKKVSEMGTFKEILEEHPMCAGCAMTLFI
RLTMIGLPNPEHTILIGTAGCGRLALTQSSIPFIYGNYGDTNAVASGLKRGLATRFPDQN
KDVVVMAGDGGLADIGFSAVMHSWFRKEKFTTIMLDNEVYGNTGGQESGMTERGAILKMA
PKGKQFEKMDMLGLAKTANVAYIARVTPTNPTRVASTVRKAVMIAREIGPTFIQAYTSCN
IEYAIPTPKVMDDAKEVENARYGFLEIMSDEAREYLESLEPAKKTKTK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgataatattaaaatgtctccggctctggaaaaatatatgaccaaagagtat
cgggacctggttgaaagagggccttacggaaagcagaagaaggtttccgaaatgggaaca
tttaaggaaatccttgaagagcatccgatgtgtgcaggatgcgcgatgactttgtttata
cgccttacaatgattggtttaccgaatcctgagcatacgattttaatcggaacagcaggg
tgtggtcggcttgccctgacacaaagttcgattccctttatctatggaaactatggggat
acgaatgcggtggcttctggtcttaaaagaggattggccacccgcttccctgaccagaac
aaggatgttgttgttatggcaggtgatggtggcttggcggatattggtttcagtgcggtg
atgcactcctggttccggaaagaaaaatttacgacgatcatgcttgacaatgaggtctat
ggcaacactggtggtcaggaatcgggaatgacggaaagaggtgctattctcaagatggca
ccaaaaggaaaacagtttgaaaaaatggatatgctcggtttggcaaaaacagcgaatgtt
gcctatatcgccagggttaccccaaccaatccaacacgggtggcctcgactgttcgcaag
gctgtgatgatcgccagggaaattgggccgacatttattcaggcctatacatcatgcaat
attgagtatgcgattccgacaccaaaagtgatggatgatgcaaaagaagtggaaaacgcc
cgctatggattcctggaaatcatgtccgatgaggcgagggaataccttgaatcccttgag
ccagcaaaaaagacaaaaacgaagtag

DBGET integrated database retrieval system