KEGG   Leptospirillum ferriphilum ML-04: LFML04_2423Help
Entry
LFML04_2423       CDS       T02319                                 

Gene name
forB2
Definition
Pyruvate synthase subunit beta/Pyruvate ferredoxin oxidoreductase
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
lfi  Leptospirillum ferriphilum ML-04
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LFML04_2423 (forB2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFML04_2423 (forB2)
   00020 Citrate cycle (TCA cycle)
    LFML04_2423 (forB2)
   00620 Pyruvate metabolism
    LFML04_2423 (forB2)
   00640 Propanoate metabolism
    LFML04_2423 (forB2)
   00650 Butanoate metabolism
    LFML04_2423 (forB2)
  Energy metabolism
   00680 Methane metabolism
    LFML04_2423 (forB2)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LFML04_2423 (forB2)
Enzymes [BR:lfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LFML04_2423 (forB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2301256..2302122)
Genome map
AA seq 288 aa AA seqDB search
MSFDNIKMSPALEKYMTKEYRDLVERGPYGKQKKVSEMGTFKEILEEHPMCAGCAMTLFI
RLTMIGLPNPEHTILIGTAGCGRLALTQSSIPFIYGNYGDTNAVASGLKRGLATRFPDQN
KDVVVMAGDGGLADIGFSAVMHSWFRKEKFTTIMLDNEVYGNTGGQESGMTERGAILKMA
PKGKQFEKMDMLGLAKTANVAYIARVTPTNPTRVASTVRKAVMIAREIGPTFIQAYTSCN
IEYAIPTPKVMDDAKEVENARYGFLEIMSDEAREYLESLEPAKKTKTK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgataatattaaaatgtctccggctctggaaaaatatatgaccaaagagtat
cgggacctggttgaaagagggccttacggaaagcagaagaaggtttccgaaatgggaaca
tttaaggaaatccttgaagagcatccgatgtgtgcaggatgcgcgatgactttgtttata
cgccttacaatgattggtttaccgaatcctgagcatacgattttaatcggaacagcaggg
tgtggtcggcttgccctgacacaaagttcgattccctttatctatggaaactatggggat
acgaatgcggtggcttctggtcttaaaagaggattggccacccgcttccctgaccagaac
aaggatgttgttgttatggcaggtgatggtggcttggcggatattggtttcagtgcggtg
atgcactcctggttccggaaagaaaaatttacgacgatcatgcttgacaatgaggtctat
ggcaacactggtggtcaggaatcgggaatgacggaaagaggtgctattctcaagatggca
ccaaaaggaaaacagtttgaaaaaatggatatgctcggtttggcaaaaacagcgaatgtt
gcctatatcgccagggttaccccaaccaatccaacacgggtggcctcgactgttcgcaag
gctgtgatgatcgccagggaaattgggccgacatttattcaggcctatacatcatgcaat
attgagtatgcgattccgacaccaaaagtgatggatgatgcaaaagaagtggaaaacgcc
cgctatggattcctggaaatcatgtccgatgaggcgagggaataccttgaatcccttgag
ccagcaaaaaagacaaaaacgaagtag

DBGET integrated database retrieval system