KEGG   Lactobacillus fermentum CECT 5716: LC40_0041Help
Entry
LC40_0041         CDS       T01958                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC40_0041
  Amino acid metabolism
   00300 Lysine biosynthesis
    LC40_0041
Enzymes [BR:lfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LC40_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70842..71738
Genome map
AA seq 298 aa AA seqDB search
MMDQXERTRVLSBLVKINSVNGNELEVANYLRRLFEQHGLTADVQPFGEQRANLIVEVGA
GKPILGITGHMDTVALGDEKKWHHAPLSATIEGDRLYGRGAADMKSGLAAQVIALIELVE
SGTLTGHVRFIATAGEEYGTPGANRLEEAGVAKDLNALVVGEPTSGNVIYAHSGSYNYRI
VSTGQAVHSSEPERGQNALEPLVDFALAERDLFFDVPDDPCLGPLKHSVTIIQGGEQVNT
IPDYAELRGNIRPTMRFDNDHVTARLQAAVDRLNQEGAAHLTPGSXPLLAXGGLXSXR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcaaaycgaacggacccgggtgcttagcracctggtcaaaattaatagtgtc
aacggcaatgaactagaagtggccaattacttgcgccgcctgtttgaacagcacgggttg
acggccgacgtccagcccttcggcgagcagcgggccaacctgattgtagaggtgggcgcc
ggtaaaccaatcctggggatcaccggccacatggacacggtcgccctgggcgatgaaaag
aagtggcaccacgcccccctgagcgccacgattgaaggggaccgcctgtacggacgaggg
gccgccgacatgaagtcgggcctggccgcccaggtgattgccctgattgaattggttgaa
tcaggaaccctgactggtcatgtccgcttcatcgctacggctggtgaggagtacgggacc
ccgggtgctaaccgcctggaagaagcgggggtggctaaggacctgaacgccctggtggtc
ggggagcccaccagcgggaacgtcatctacgcccattcgggaagctacaactaccggatc
gtttcaactggccaggcggtgcactcttcggaaccggaacgtggccaaaacgccctggag
cccctggtcgactttgccctggccgaacgcgacctcttctttgacgttccggatgacccc
tgcctggggccgctcaagcactcggtgacgattattcaggggggcgagcaggtcaacacg
attccggattacgcggagttgcgggggaacatccgccccacgatgcgcttcgataacgac
cacgttaccgcccgtttgcaggccgccgtggaccgkcttaaccaggagggtgctgcccat
ttaacccctggaagtrctccactcctggcgyccggtggcctccratcccracggtga

DBGET integrated database retrieval system