KEGG   Lactobacillus fermentum CECT 5716: LC40_0148Help
Entry
LC40_0148         CDS       T01958                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LC40_0148
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LC40_0148
Enzymes [BR:lfr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LC40_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248925..250193
Genome map
AA seq 422 aa AA seqDB search
MKKMIIQGGNRLSGEVTIGGAKNSTVALIPSAILADTPVQFDTVPDILDVHNLMIILESM
NVHSSFKHGVLDIDPTQIIEAELPSKAIKSLRASYYFMGALLGRFHRATLTFPGGDNIGP
RPIDQHLKAFEALGATVSENNGTVHLEAPNGLHGTRIFMDMVSVGATINAILAAVRAEGV
TIIENAAREPEIVDLATFLNNMGAQIRGVGTDVIRITGVNSLQSMNTHTIIADRIESGTY
LSLAAAMGDGVMINNVIPEHLEAYTSKLIEMGVDLKIDSDKIYVPKAEHLTAVHVKTMPY
PGFATDLQQPLTPLMAKAAGVSTVVDTIYPKRVKHIPELQKMGMKIAAGDGKITIEHTDH
FNGADVEAGEIRAGASLVITGLMADGQTVIHKADNILRGYDRIVWKLNRLNANVRIEDDE
QD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgatcattcaaggagggaaccgactctcgggcgaagtaacgatcggtggc
gccaagaatagcaccgtcgcgctcattccatcggcgatcctggccgatactcccgtccag
tttgatactgtgccggacatcctggatgttcacaatcttatgattatcttagagtcaatg
aacgtgcactcttcctttaagcacggggtgttagacattgacccaactcaaatcattgaa
gccgaactgcctagcaaggccattaagagtttgcgggcatcgtattactttatgggagcg
ctactcggccgcttccaccgggcaaccttaaccttccccgggggcgataacattggcccc
cggccgatcgaccaacacttaaaggcctttgaagccctgggtgctaccgttagtgaaaac
aacgggaccgtccacttggaggcaccaaatggcctgcacggaacgcggatcttcatggac
atggtgtccgtgggggccacgatcaacgccatcttggcggcggtccgtgccgaaggggta
acgattatcgaaaacgccgcccgggaaccagagattgtggaccttgccacctttttgaat
aacatgggggcgcagatccgcggggtcgggaccgacgtgattcggattaccggggtgaac
tccctgcaatcgatgaacacgcacacgatcattgcggaccggattgaatccggcacctac
ctttcccttgcggccgccatgggcgatggggtgatgatcaataacgtcatccctgaacac
ttggaagcctacactagtaagttgatcgaaatgggggttgatttgaagatcgattccgat
aagatctacgtgcctaaggcggagcacttaacggcggttcacgttaagacgatgccgtac
ccgggctttgctaccgacttacaacaaccgttgaccccgttgatggccaaggccgccggg
gtaagcacggtggtggatacgatctatcctaagcgggtcaagcacatccccgaattgcaa
aagatggggatgaagatcgcagccggcgacggaaagattacgatcgagcacaccgatcac
tttaacggcgctgacgttgaggccggtgaaattcgggccggggcttccctggtgattacc
gggttaatggcagacggtcaaaccgttatccacaaggccgacaacatcctacgtggttac
gaccgcattgtttggaagctcaatcgtctaaacgccaacgtccggattgaagacgatgag
caagactag

DBGET integrated database retrieval system