KEGG   Lactobacillus fermentum CECT 5716: LC40_0194Help
Entry
LC40_0194         CDS       T01958                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LC40_0194
Enzymes [BR:lfr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LC40_0194
Amino acid related enzymes [BR:lfr01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LC40_0194
Transfer RNA biogenesis [BR:lfr03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LC40_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326952..328448
Genome map
AA seq 498 aa AA seqDB search
MSKNEIRVRYAPSPTGHLHIGNARTALFNYLFARHNHGKFIIRIEDTDTKRNIADGERSQ
LDNLKWMGLDWDEGPDKGGDFGPYRQSERKDIYAQYIQELMDKGLAYKSYMTEEELEAQR
EAQKAAHQMPHYEYEYAGMSDDQIKAAQEAAEEKGLKPVIRFRVPKDEVFEWEDLVKGPM
SFEAQSIGGDFVIQKRDGMPTYNFAVVIDDHLMKISHVFRGDDHVSNTPKQMAIYQALGW
KVPEFGHMSLIINNETGKKLSKRDESVLQFIEQYRDLGYLPEAMDNFIILLGWSPVGEDE
IFSLKEFVKMYDEKRLSKSPAAFDRKKLQWINNQYMKLSSADEVFHVAMPQLLDAGLIEK
NANPYKMEWMRRLVELFKREISYAREIVDYVKPFVNGPEDISEEAKAEMQEDTALVVIKA
FRDRVAAMDFMDATGVLAAIKDVQKSTKVKGRKLWMPLRIAVTHETHGPELPESIELFGQ
EKTLAHLDEMIAQLEENK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaagaatgaaattcgcgttcgttacgctcctagtccgaccggacacctacacatt
gggaacgcacggaccgcattgttcaactacttatttgcccggcacaaccacggaaagttt
atcatccggattgaagacaccgacaccaagcgcaacattgcggacggggaacgcagccag
ctcgacaacctgaagtggatggggctggactgggatgaaggtccggataagggcggcgac
tttggtccttaccgccaatccgaacgtaaggacatctatgcccaatacattcaagaatta
atggataagggcctggcttacaagtcctacatgaccgaagaggaactggaggcccaacgg
gaagcccaaaaggcggcccaccaaatgccacactatgaatacgaatatgccggcatgagc
gatgaccaaatcaaggcggcccaagaagcagccgaagaaaagggattaaagccggtcatc
cggttccgggtacctaaggatgaagtctttgaatgggaagacctggttaagggacccatg
tcgtttgaggcccaatcaattgggggcgactttgtcatccaaaagcgcgacgggatgcca
acgtacaactttgccgttgtcattgacgaccacctgatgaagatcagccacgtgttccgc
ggcgatgaccacgtttctaacacgccaaagcaaatggccatctaccaagccctgggctgg
aaggtaccggaatttggccacatgtccttgatcatcaataacgaaaccggtaagaagctt
tccaagcgggacgaatcggtgctccaattcatcgagcaataccgcgacctggggtacctg
ccggaagcaatggataacttcatcatcctcttgggctggtccccggttggggaagacgaa
atcttctccttaaaggaattcgttaagatgtacgatgaaaagcggctgtccaagtcacca
gccgcctttgaccgcaagaagctccagtggatcaacaaccagtacatgaaactttcgtca
gccgatgaggtcttccacgtggccatgccacagctgttggacgctggtttgattgaaaag
aacgccaacccatacaagatggaatggatgcggcggttagtggaactcttcaagcgcgaa
atttcttacgcaagagaaattgtcgactacgttaagccgtttgtgaacggcccggaagac
atttctgaagaagcgaaggccgaaatgcaagaagacaccgccctggtagtgattaaggcc
ttccgggaccgggttgccgccatggacttcatggacgcaaccggtgtcttagccgccatt
aaggacgtgcaaaagagtaccaaggtgaaggggcgcaagctctggatgccactgcggatc
gccgtaacccacgaaacgcacgggccggagttaccggaaagcatcgaactctttgggcag
gaaaagaccttggcccacttggatgagatgattgcccagttagaagaaaataagtaa

DBGET integrated database retrieval system