KEGG   Lactobacillus fermentum CECT 5716: LC40_0237Help
Entry
LC40_0237         CDS       T01958                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lfr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lfr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lfr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lfr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
409251..410162
Genome map
AA seq 303 aa AA seqDB search
MKQVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEARKSGIEDIVVVDGKN
KRSIEDHFDSNPELEDNLRDKHKDEMLKLVQETTDINIYFIRQSHPRGLGDAVLTARDFI
GDEPFVVMLGDDLNNINGDAEPLTKELINSYEETGASTLAVMRVPHEDTAKYGVINPSKE
VMPGLYNVTSFVEKPEPKDAPSDLAIIGRYVFTPEIFDVLAKTKPGKGNEIQLTDAINTL
NKTQRVFAHEYKGHRYDVGNKFGWIETNIEYGLKHPETKDELREYIKDLGVKFAAEDKKK
PAK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtaagaaaagcaattattccggcagccggcttagggacgcgctttttgcca
gccaccaaggccttagcaaaggaaatgttaccaatcgtcgacaagccaaccattcaattc
atcgttgaagaagcccgtaagtccgggattgaagacatcgtggtggttgatgggaagaac
aagcgctccatcgaagaccacttcgactctaacccagaactggaagataacctgcgcgat
aagcacaaggatgagatgctcaagctggttcaagaaaccactgacattaacatctacttc
atccgccaatcccacccacgtggtttgggggacgccgtgttgaccgcccgtgacttcatt
ggcgacgaaccgttcgtggtaatgcttggtgacgacttgaacaacattaacggcgatgcc
gaaccgttgaccaaggaattaatcaactcttacgaagaaaccggtgcatcaaccttagca
gttatgcgggtgccgcacgaagacaccgccaagtacggggtcatcaacccaagcaaggaa
gtaatgccgggtctttacaacgttacctccttcgtggaaaagccggaaccaaaggatgcg
ccaagtgacttggccatcatcggccgctacgtcttcacgccagaaatttttgatgtactg
gccaagaccaagccgggtaagggtaacgaaattcaactgactgatgccatcaacacctta
aacaagacgcaacgggtctttgcacacgaatacaagggtcaccgttacgacgtcggcaac
aagtttggctggattgaaactaacattgaatacggcctcaagcacccggaaaccaaggat
gaactccgtgagtacatcaaggatttgggcgttaagttcgccgctgaagacaagaagaag
ccagcaaaataa

DBGET integrated database retrieval system