KEGG   Lactobacillus fermentum CECT 5716: LC40_0292Help
Entry
LC40_0292         CDS       T01958                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lfr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lfr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lfr00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lfr00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495906..496682
Genome map
AA seq 258 aa AA seqDB search
MRKPFVVANWKMHKSVDEALDFIRSLQGRLPDADLVECGVAANFLALYPMLQEVKGQPLE
IISQNAYAEYEGAYTGEVSPKALADAGINYALLGHIERRKLFNETDDLVNRKVIATLQAG
MTPIICTDETMIQKEFSGSVHYVFEQLINVLRGVSFDQVKNIIISYEPSWAVGVGQHANP
NLAEEGCRLIRQTIADSYSYEVADKIRILYGGSVNPENIKQIMNKPDIDGVLIGRASLDT
DNFLSMINTVVELYKGAK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccatttgtggtcgcgaattggaaaatgcacaagagcgttgatgaagcgtta
gactttatccggagcttgcaaggccggcttcccgatgccgacttagtcgaatgcggggtc
gccgccaatttcttagccctgtacccaatgttacaagaggtcaagggccaaccgctggaa
attatttcgcaaaacgcctatgccgaatacgagggggcctacaccggtgaggtaagtcct
aaggccctggccgacgccggaattaattatgccttgttaggccacattgaacggcgcaag
ctttttaatgaaacggacgatttggttaaccgaaaggtaatcgctaccttgcaggccggg
atgaccccgattatttgtaccgatgagacgatgattcaaaaagagtttagtggtagcgtc
cactacgtctttgaacagttaatcaacgtcttgcggggcgtttccttcgaccaggtaaaa
aacattatcatttcttacgaaccgagctgggcggtcggggttggtcaacacgccaacccg
aacctggccgaagaagggtgccgcctgattcggcaaacgatcgccgactcgtattcttac
gaggtggccgataagatccgaatcctctacggtgggagcgttaatcccgaaaacattaag
caaatcatgaacaaaccggacattgatggggtcttaattggccgggcaagcctcgacacc
gataacttcttgtcgatgatcaatacggtagtcgaactttataagggtgctaaatag

DBGET integrated database retrieval system