KEGG   Lactobacillus fermentum CECT 5716: LC40_0292Help
Entry
LC40_0292         CDS       T01958                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LC40_0292
   01230 Biosynthesis of amino acids
    LC40_0292
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC40_0292
   00051 Fructose and mannose metabolism
    LC40_0292
   00562 Inositol phosphate metabolism
    LC40_0292
Enzymes [BR:lfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LC40_0292
Exosome [BR:lfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LC40_0292
  Exosomal proteins of bladder cancer cells
   LC40_0292
  Exosomal proteins of melanoma cells
   LC40_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495906..496682
Genome map
AA seq 258 aa AA seqDB search
MRKPFVVANWKMHKSVDEALDFIRSLQGRLPDADLVECGVAANFLALYPMLQEVKGQPLE
IISQNAYAEYEGAYTGEVSPKALADAGINYALLGHIERRKLFNETDDLVNRKVIATLQAG
MTPIICTDETMIQKEFSGSVHYVFEQLINVLRGVSFDQVKNIIISYEPSWAVGVGQHANP
NLAEEGCRLIRQTIADSYSYEVADKIRILYGGSVNPENIKQIMNKPDIDGVLIGRASLDT
DNFLSMINTVVELYKGAK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccatttgtggtcgcgaattggaaaatgcacaagagcgttgatgaagcgtta
gactttatccggagcttgcaaggccggcttcccgatgccgacttagtcgaatgcggggtc
gccgccaatttcttagccctgtacccaatgttacaagaggtcaagggccaaccgctggaa
attatttcgcaaaacgcctatgccgaatacgagggggcctacaccggtgaggtaagtcct
aaggccctggccgacgccggaattaattatgccttgttaggccacattgaacggcgcaag
ctttttaatgaaacggacgatttggttaaccgaaaggtaatcgctaccttgcaggccggg
atgaccccgattatttgtaccgatgagacgatgattcaaaaagagtttagtggtagcgtc
cactacgtctttgaacagttaatcaacgtcttgcggggcgtttccttcgaccaggtaaaa
aacattatcatttcttacgaaccgagctgggcggtcggggttggtcaacacgccaacccg
aacctggccgaagaagggtgccgcctgattcggcaaacgatcgccgactcgtattcttac
gaggtggccgataagatccgaatcctctacggtgggagcgttaatcccgaaaacattaag
caaatcatgaacaaaccggacattgatggggtcttaattggccgggcaagcctcgacacc
gataacttcttgtcgatgatcaatacggtagtcgaactttataagggtgctaaatag

DBGET integrated database retrieval system