KEGG   Lactobacillus fermentum CECT 5716: LC40_0292Help
Entry
LC40_0292         CDS       T01958                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
lfr00010  Glycolysis / Gluconeogenesis
lfr00051  Fructose and mannose metabolism
lfr01100  Metabolic pathways
lfr01110  Biosynthesis of secondary metabolites
lfr01120  Microbial metabolism in diverse environments
lfr01130  Biosynthesis of antibiotics
lfr01200  Carbon metabolism
lfr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC40_0292
   00051 Fructose and mannose metabolism
    LC40_0292
   00562 Inositol phosphate metabolism
    LC40_0292
Enzymes [BR:lfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LC40_0292
Exosome [BR:lfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LC40_0292
  Exosomal proteins of bladder cancer cells
   LC40_0292
  Exosomal proteins of melanoma cells
   LC40_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADJ40938
UniProt: D8IH07
Position
495906..496682
Genome map
AA seq 258 aa AA seqDB search
MRKPFVVANWKMHKSVDEALDFIRSLQGRLPDADLVECGVAANFLALYPMLQEVKGQPLE
IISQNAYAEYEGAYTGEVSPKALADAGINYALLGHIERRKLFNETDDLVNRKVIATLQAG
MTPIICTDETMIQKEFSGSVHYVFEQLINVLRGVSFDQVKNIIISYEPSWAVGVGQHANP
NLAEEGCRLIRQTIADSYSYEVADKIRILYGGSVNPENIKQIMNKPDIDGVLIGRASLDT
DNFLSMINTVVELYKGAK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccatttgtggtcgcgaattggaaaatgcacaagagcgttgatgaagcgtta
gactttatccggagcttgcaaggccggcttcccgatgccgacttagtcgaatgcggggtc
gccgccaatttcttagccctgtacccaatgttacaagaggtcaagggccaaccgctggaa
attatttcgcaaaacgcctatgccgaatacgagggggcctacaccggtgaggtaagtcct
aaggccctggccgacgccggaattaattatgccttgttaggccacattgaacggcgcaag
ctttttaatgaaacggacgatttggttaaccgaaaggtaatcgctaccttgcaggccggg
atgaccccgattatttgtaccgatgagacgatgattcaaaaagagtttagtggtagcgtc
cactacgtctttgaacagttaatcaacgtcttgcggggcgtttccttcgaccaggtaaaa
aacattatcatttcttacgaaccgagctgggcggtcggggttggtcaacacgccaacccg
aacctggccgaagaagggtgccgcctgattcggcaaacgatcgccgactcgtattcttac
gaggtggccgataagatccgaatcctctacggtgggagcgttaatcccgaaaacattaag
caaatcatgaacaaaccggacattgatggggtcttaattggccgggcaagcctcgacacc
gataacttcttgtcgatgatcaatacggtagtcgaactttataagggtgctaaatag

DBGET integrated database retrieval system