KEGG   Lactobacillus fermentum CECT 5716: LC40_0292Help
Entry
LC40_0292         CDS       T01958                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LC40_0292
   01230 Biosynthesis of amino acids
    LC40_0292
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC40_0292
   00051 Fructose and mannose metabolism
    LC40_0292
   00562 Inositol phosphate metabolism
    LC40_0292
Enzymes [BR:lfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LC40_0292
Exosome [BR:lfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LC40_0292
  Exosomal proteins of bladder cancer cells
   LC40_0292
  Exosomal proteins of melanoma cells
   LC40_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495906..496682
Genome map
AA seq 258 aa AA seqDB search
MRKPFVVANWKMHKSVDEALDFIRSLQGRLPDADLVECGVAANFLALYPMLQEVKGQPLE
IISQNAYAEYEGAYTGEVSPKALADAGINYALLGHIERRKLFNETDDLVNRKVIATLQAG
MTPIICTDETMIQKEFSGSVHYVFEQLINVLRGVSFDQVKNIIISYEPSWAVGVGQHANP
NLAEEGCRLIRQTIADSYSYEVADKIRILYGGSVNPENIKQIMNKPDIDGVLIGRASLDT
DNFLSMINTVVELYKGAK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccatttgtggtcgcgaattggaaaatgcacaagagcgttgatgaagcgtta
gactttatccggagcttgcaaggccggcttcccgatgccgacttagtcgaatgcggggtc
gccgccaatttcttagccctgtacccaatgttacaagaggtcaagggccaaccgctggaa
attatttcgcaaaacgcctatgccgaatacgagggggcctacaccggtgaggtaagtcct
aaggccctggccgacgccggaattaattatgccttgttaggccacattgaacggcgcaag
ctttttaatgaaacggacgatttggttaaccgaaaggtaatcgctaccttgcaggccggg
atgaccccgattatttgtaccgatgagacgatgattcaaaaagagtttagtggtagcgtc
cactacgtctttgaacagttaatcaacgtcttgcggggcgtttccttcgaccaggtaaaa
aacattatcatttcttacgaaccgagctgggcggtcggggttggtcaacacgccaacccg
aacctggccgaagaagggtgccgcctgattcggcaaacgatcgccgactcgtattcttac
gaggtggccgataagatccgaatcctctacggtgggagcgttaatcccgaaaacattaag
caaatcatgaacaaaccggacattgatggggtcttaattggccgggcaagcctcgacacc
gataacttcttgtcgatgatcaatacggtagtcgaactttataagggtgctaaatag

DBGET integrated database retrieval system