KEGG   Lactobacillus fermentum CECT 5716: LC40_0412Help
Entry
LC40_0412         CDS       T01958                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LC40_0412
Enzymes [BR:lfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LC40_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
695915..698461
Genome map
AA seq 848 aa AA seqDB search
MAYRDYTQPVIHDEKVQETGPTHFSGRVRKVIFSNPPFAILAVTVLKADFEWDTEEITVK
GDVGQVNEGDEFEFEGQVVNNPRYGFEFDFSGFVHQLPHDAKELAAFLKKNNVAVSDEKK
VAKAIDDALGEKAMSTLIGDADAIEVVSGLSQKDIATLKTFFNRLVKDDEASKANRQLMM
LGFSAWMIRRLQEFYQRRLLKILEEDIYQVVADYEQLGISFRPVDEAARQYQDVAFDDPR
RIDGALLFAAQILIRENSGSYVAPQLLLNRASQLLNQGATVSQDTLAARLGILLTQKKLY
HVPERGIYPALFFHAENLIASQLHQMMAAAQPVSAKRQKLIEKIVDQVAKEQKITYDDQQ
KAAIKQALEAPVLLLTGGPGTGKTTILNGIVRAYRRLLKEDGQKLHAWSDGEPIQLVAPT
GRAAKQARQAITGEGVAASTIHHFLSIATDNDAARLIEKPAPLENAGQMLVVDEMSMTST
LLMGGLMAVIPTNIHLVLVGDFDQLPSVGPGQVFRDLLESNCLPQVRLERIYRQDADSSL
IPLAQRINKGDVDEDFIAPTPKTKYPKRIFVTTAARDVPARIGQLVDAYLGGHDLDIQDI
QILTPLRRHRDLINSYLQDHLNPASLNQATYRLRSRELRVGDKVMQTTNDSDAEVYNGDI
GIIKSIAGKDKHVVNGDRLAKKEKVHLKVTVDFAGHLVKYDDPTALANLELAYAMTIHKA
QGSQAPVVIVTLLSEFFPTNPQAGSIIQRNLLYTAVTRSSRALVMVGDAPAFVRCSKTPV
VDRPTSLKQRLKLVWQAAQQDPDSPADEKAQTPVQEEQPADHLTPAMVEDERVDPLIGMD
GLSPADFA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggcgtaccgggattatacccagccggtaattcatgacgaaaaggtccaagaaacggga
ccaacgcatttttcggggcgggtacgaaaagttatcttttctaacccgccctttgctatt
ttagcggtgacggtgttaaaggctgactttgagtgggacaccgaagaaatcaccgttaag
ggtgacgttggtcaagttaacgagggcgatgagtttgaatttgagggtcaggttgtcaac
aacccgcgctacggctttgagtttgatttttcgggctttgtccaccagctgcctcacgac
gccaaggagctggccgcctttttaaagaagaacaacgtggcggtcagtgatgagaaaaag
gtggccaaggccattgatgacgccttaggcgaaaaggccatgagcaccctgattggcgac
gccgacgcaatcgaagtggtgtccgggttgagtcaaaaagacatcgcgaccttaaagacc
tttttcaaccggttggtcaaagatgacgaggccagcaaggccaaccgccagttgatgatg
ctcggtttctcggcctggatgatccgccgcttgcaggaattctaccaacggcggttgctt
aaaatcctcgaagaagacatttaccaagtggtagccgattatgagcagttggggattagt
tttcgcccggtggatgaggcggcacgccagtatcaagacgtggccttcgatgatccccgc
cgcatcgatggggctctcctctttgccgcccaaattctgattcgggaaaattccggctcg
tacgtcgccccgcaattactgttgaaccgggctagccaactccttaaccagggcgccacc
gtcagccaggataccctggcggcgcgtttgggaattttactgacccaaaagaagctttac
cacgtgcccgagcggggaatctacccggccctgttctttcacgccgaaaatttaattgcc
agtcagcttcaccagatgatggcggcggcccagccggtcagcgccaagcggcaaaagctg
attgaaaagatagttgatcaggtggccaaggaacaaaaaatcacttacgacgaccagcaa
aaggcggcgattaaacaggccttagaagcaccggtgctgctcttgaccgggggaccgggg
accgggaagacgacgattctaaacgggatcgtgcgggcataccggcgcctgttaaaagag
gacggccaaaagctccacgcttggagcgatggggaaccaattcagttagttgcccccacc
gggcgggcggctaagcaagcccgccaggcgatcacgggtgagggcgttgccgcgtcaacc
atccaccacttcttgagcattgcaaccgataacgatgccgcccgtttgattgaaaaaccg
gcgcccctagaaaatgccggtcagatgctggtggttgacgaaatgtcgatgacctccacc
ctcttgatgggggggctaatggcggtgatcccgaccaacatccacttagtgttagtcggt
gacttcgatcagctgccgtcggtgggaccggggcaggtgttccgggacttgctcgaatct
aattgcttaccgcaagtccgcttggaacggatttaccgccaggacgccgattcctctttg
atcccgttagcccagcggatcaacaagggggacgttgacgaggacttcattgcccccacc
ccaaagactaagtaccccaagcgaatctttgtgaccaccgccgctcgcgacgttccggcc
cggattggtcagctagtcgacgcctacttgggtggtcacgacttggatattcaagatatt
cagatcttaaccccgctacggcgccaccgcgacctgattaatagctacttgcaagaccac
ctgaatccggccagcttaaaccaggccacttaccggttacgaagccgggagctacgggtg
ggcgacaaggtaatgcagacaacgaacgactccgacgccgaggtttataacggtgacatc
gggatcatcaagtcgattgccgggaaagataagcacgtcgttaacggcgatcggctcgcc
aaaaaggagaaggtgcacctgaaggtcacggtcgactttgctggccacctggttaaatac
gatgaccccaccgccctggctaacttagaactggcctacgcgatgacgattcacaaggcc
caggggagtcaggcgccggtcgtgattgtgaccttgctgtcggagtttttcccgactaac
ccccaggctggttcaatcatccaacgtaacctcttgtacacggcagtgacccggtcgtcg
cgggctctggtgatggtgggtgacgccccggccttcgtgcgttgctctaagacgccggtg
gtggaccgccccacctcgctcaagcagcgactgaagttggtttggcaagcagcccagcag
gatccagactccccggcagacgagaaagcccagacgccggttcaagaagaacaaccagcg
gatcacttgacgccggcaatggtggaagacgaacgggtggacccgctgatcggcatggat
ggattaagtccggccgactttgcctaa

DBGET integrated database retrieval system