KEGG   Lactobacillus fermentum CECT 5716: LC40_0512Help
Entry
LC40_0512         CDS       T01958                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lfr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lfr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893661..894569
Genome map
AA seq 302 aa AA seqDB search
MPGGTAAYPSTILMNAIPAKLAGVGKLVMVTPPQREGISQTVLAAAYLAGVDAVYQVGGA
QAIAALAYGTESIPQVDKIVGPGNIFVATAKQQVFGQVAIDMVAGPSEIGIIADSNANPD
EVAADLLSQAEHDRRARAMLVTDSVELAEAVSAAVDQQLKTLPRQEIAQEAIANRSFIAV
MADQDEMFELMNSIAPEHLELQVQDPITAMGKVQNAGSVFLGRYASEPLGDYLAGPNHVL
PTGGTARFASPLGVYDFVKRTQFLQYTEAALAGVVQEVADLARAEGLEAHARAVEARFKE
GD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgccggggggcaccgccgcgtacccgtcgacgatcctgatgaacgcgattcccgccaag
ctagcgggggtcggtaagttggtgatggtcacgccgccgcaaagggaggggatctcccag
acggtgctggccgccgcctacctggccggcgtcgacgccgtttaccaagtcgggggtgcc
caagcgatcgccgccttagcctacgggaccgaaagcatcccgcaagtcgataagatcgtt
ggcccggggaacatcttcgtcgccaccgctaagcaacaggtttttggccaggtcgccatc
gacatggtggccgggccgtcggaaatcgggatcatcgcggacagcaacgccaacccggac
gaagtggccgccgacctcttatcgcaggccgaacacgaccggcgcgcccgggcgatgcta
gtcaccgacagcgtggaactggccgaggccgtttccgccgccgttgaccagcagttaaaa
accctgccacgtcaggaaattgcccaagaagcgatcgccaaccgtagcttcattgccgta
atggcggaccaagacgaaatgtttgaactgatgaattcgattgccccggagcacttggaa
ctccaggtccaggacccgatcaccgcgatgggcaaggtgcaaaacgccggctcggtcttc
ttgggccgttacgcctccgagccgctcggcgattacctagccgggccaaaccacgtcttg
ccaaccgggggaaccgcccgctttgcctcaccactaggggtgtacgatttcgttaagcgg
acccagttcttgcaatacaccgaagccgccctggccggggtggtgcaagaagtcgccgac
ttggcccgggccgaggggctggaggcccacgcccgcgccgttgaagcccgttttaaggag
ggagattaa

DBGET integrated database retrieval system