KEGG   Lactobacillus fermentum CECT 5716: LC40_0512Help
Entry
LC40_0512         CDS       T01958                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
lfr00340  Histidine metabolism
lfr01100  Metabolic pathways
lfr01110  Biosynthesis of secondary metabolites
lfr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    LC40_0512
Enzymes [BR:lfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LC40_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh GNAT_acetyltran
Motif
Other DBs
NCBI-ProteinID: ADJ41128
UniProt: D8IHJ7
Position
893661..894569
Genome map
AA seq 302 aa AA seqDB search
MPGGTAAYPSTILMNAIPAKLAGVGKLVMVTPPQREGISQTVLAAAYLAGVDAVYQVGGA
QAIAALAYGTESIPQVDKIVGPGNIFVATAKQQVFGQVAIDMVAGPSEIGIIADSNANPD
EVAADLLSQAEHDRRARAMLVTDSVELAEAVSAAVDQQLKTLPRQEIAQEAIANRSFIAV
MADQDEMFELMNSIAPEHLELQVQDPITAMGKVQNAGSVFLGRYASEPLGDYLAGPNHVL
PTGGTARFASPLGVYDFVKRTQFLQYTEAALAGVVQEVADLARAEGLEAHARAVEARFKE
GD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgccggggggcaccgccgcgtacccgtcgacgatcctgatgaacgcgattcccgccaag
ctagcgggggtcggtaagttggtgatggtcacgccgccgcaaagggaggggatctcccag
acggtgctggccgccgcctacctggccggcgtcgacgccgtttaccaagtcgggggtgcc
caagcgatcgccgccttagcctacgggaccgaaagcatcccgcaagtcgataagatcgtt
ggcccggggaacatcttcgtcgccaccgctaagcaacaggtttttggccaggtcgccatc
gacatggtggccgggccgtcggaaatcgggatcatcgcggacagcaacgccaacccggac
gaagtggccgccgacctcttatcgcaggccgaacacgaccggcgcgcccgggcgatgcta
gtcaccgacagcgtggaactggccgaggccgtttccgccgccgttgaccagcagttaaaa
accctgccacgtcaggaaattgcccaagaagcgatcgccaaccgtagcttcattgccgta
atggcggaccaagacgaaatgtttgaactgatgaattcgattgccccggagcacttggaa
ctccaggtccaggacccgatcaccgcgatgggcaaggtgcaaaacgccggctcggtcttc
ttgggccgttacgcctccgagccgctcggcgattacctagccgggccaaaccacgtcttg
ccaaccgggggaaccgcccgctttgcctcaccactaggggtgtacgatttcgttaagcgg
acccagttcttgcaatacaccgaagccgccctggccggggtggtgcaagaagtcgccgac
ttggcccgggccgaggggctggaggcccacgcccgcgccgttgaagcccgttttaaggag
ggagattaa

DBGET integrated database retrieval system