KEGG   Lactobacillus fermentum CECT 5716: LC40_0728Help
Entry
LC40_0728         CDS       T01958                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LC40_0728
Enzymes [BR:lfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LC40_0728
Exosome [BR:lfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LC40_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1294506..1296017)
Genome map
AA seq 503 aa AA seqDB search
MNEQQYVMAIDEGTTSSRAIIFDHAGKEVAIAQKEFRQYFPQPGWVEHDAEEIWDSVQSV
ISEAVIKAQVKPYRIVAIGITNQRETTVIWDRKTGKPIARAIVWQSKQTAPIAERLIEEG
YTDQIHQKTGLVIDSYFSATKIKWLLDNVPGARERAKRGDLLFGTIDTWLLWNLTSGRVH
ATDVTNASRTMLFNIHTLDWDQDILDLLDIPREILPEVKPSSHVYGYTADYHFFGVQVPV
AGIAGDQQAALFGQGAFEKGSVKNTYGTGAFTVMNTGTTPMLSQNGLLTTVAYGIGNEVH
YALEGSIFVAGSAVQWLRDGLRLFKSAGESEQMAVDAQTTGGVYVVPSFTGLGAPYWDQE
VRGAMFGLTRGSSRENIVRATLEAIAYQTKDVVDTMVKDTNLPLTTLAVDGGASRNNFMM
QFQADLLQTPIVRAQIEETTALGAAFLAGLAVDFWEDQNELKQLAKSGDRFDPVMTKEEA
GRHYAGWQRAVDAVRYFSHGAEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagcaacaatatgtgatggccattgatgaggggacgacctcctcacgggcgatt
attttcgaccacgcgggtaaagaagtggcgattgcgcaaaaggaattccgtcagtacttc
ccccagcccggctgggtcgaacatgacgccgaagagatctgggatagcgttcaatcggtg
atttcagaggcggtcatcaaggcgcaagttaagccctaccggattgtggcgatcggaatt
actaaccagcgggaaaccacggtgatttgggaccggaagaccggtaaaccaatcgcccgg
gcgatagtgtggcaatcaaagcagaccgccccgattgctgaacgactaatcgaggagggc
tacacggaccagatccaccaaaagaccggcttagtcattgattcctacttctcggccacc
aagatcaagtggcttttggataacgtaccgggggcccgggagcgggctaaacgaggcgac
ctactctttggcaccatcgatacctggctcttgtggaatttaactagcgggcgggtgcac
gctacggacgttaccaacgccagccggacgatgctctttaacatccacacccttgactgg
gaccaagacattttagacctgctcgatattccccgggaaattttaccggaggtcaagccg
tcctcgcacgtctatggttacacggccgattaccacttcttcggggtccaagttccggtc
gccgggatcgccggggaccaacaggcggccctctttggccagggcgcctttgaaaagggg
agcgtcaagaatacgtacgggaccggggccttcacggtcatgaacaccgggacgacgcca
atgctttcgcaaaatggcctcctgacgacggtcgcctatgggattggcaacgaggtacat
tacgccctggaaggatcgattttcgtagcgggctcggcggttcagtggctccgcgatggg
ctacggctctttaagtcggccggggagtctgagcaaatggccgttgatgcccagaccacc
ggtggcgtgtatgtrgtgccatcctttaccggyttgggggcgccctactgggatcaagag
gtccgcggggctatgtttggcctcacccgggggagtagccgggaaaatattgtccgggcc
accttggaggcaatcgcctaccagaccaaggacgttgtggacacgatggtcaaagacact
aatttaccgttgaccaccctggcggtggatggcggggcgtcgcgcaataacttcatgatg
cagttccaagccgacctcttacaaacgccgattgtccgtgcccaaattgaagaaaccacg
gcgctaggggccgccttcttggctgggttggcggtggacttctgggaggatcaaaacgag
ctcaagcagttggctaagtcgggtgaccgttttgacccggttatgaccaaagaagaggct
gggcgtcactacgccggatggcaacgagccgtagatgccgttcgctactttagccacggt
gctgaggaatga

DBGET integrated database retrieval system