KEGG   Lactobacillus fermentum CECT 5716: LC40_0744Help
Entry
LC40_0744         CDS       T01958                                 

Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC40_0744
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC40_0744
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LC40_0744
Enzymes [BR:lfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LC40_0744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1319263..1320807)
Genome map
AA seq 514 aa AA seqDB search
MRSFFYYGREITCNTEAPATKRXKQMTAPEAILQGLAPDGGLFVPQSFPQPDYDLGALVN
APYQEVATTIWGWFFDDFSLASRQAIVRGAYGEQWDDSQIAPLSERVAGNYYLELFHGPT
LAFKDVALQALPRLMKEAVTVTGDDKQIIILTATSGDTGSAAMRGFSDVTGTQVVVFYPD
GGVSPVQLRQMLAMKGDNLAAVAVAGNFDDAQTEVKKIFNDQEFAARLAQAGDRFSSANS
MNIGRLIPQLTYYFTAYGQLVKRGEVELGAPVNFAVPTGNFGDILAGYYAKKLGLPIKKL
LCASNQNRVLTDFFATGHYDRRRPFHLTTAPAMDILVSSNLERLLFDLYDQEAGAVASLM
KELNQTGEYQVTDEVLKRLHQDFVADWASEEEISEEIRRIYLAADYVIDPHTAVGSVVAH
RYKERTGDNTPMVVVATASPYKFAETVYPAVTGKETAARGLQAIQGLNEFLGEELSPGVK
ALFEGDQRSEQRVEPSEMAQLIEKRLGLTSEQKE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagatcatttttttattacgggagggagatcacatgcaataccgaagcacccgcgacc
aagcggcycaagcaaatgacggcgcccgaggcgattttacaggggttagccccggacggg
ggcctctttgtgccccagtcgtttccccaaccagactacgacctgggggccctcgttaac
gccccctatcaagaggtcgccaccaccatttggggctggttttttgacgacttttcgctg
gcgagccgtcaagcaattgtccggggggcctatggtgagcagtgggatgattcccagatt
gcacccctaagcgagcgggtggcggggaattattacttagaactcttccacggcccaacg
ctggcttttaaggacgttgccttacaagcccttccccggttgatgaaggaggcggtcacg
gtgaccggtgatgataaacaaatcatcattttgacggccacttccggtgacactggctcg
gcggcgatgcggggctttagtgacgttaccgggacccaagtagttgttttttacccggac
ggtggggtgagcccagtccaactgcgtcaaatgctagcgatgaagggggataacctggcg
gccgtagcggtggccggcaatttcgatgacgcccaaaccgaggttaaaaagatctttaac
gaccaagaatttgccgctcggttagcccaggcgggcgaccgcttttcgtcggcgaactcg
atgaacattggccggctgattccccagcttacttattacttcaccgcttatggccagttg
gtcaagcgcggggaagttgaactcggcgccccggttaactttgccgtgccaaccgggaac
tttggggatatcctcgccggttactacgctaaaaaattaggtctgccgatcaaaaagctc
ctgtgcgcctccaaccaaaaccgggtcctgaccgacttttttgcgaccggccactatgac
cggcgccgccccttccacctcaccacggccccggcaatggacatcctagtttccagtaac
ttagagcgcctcttgtttgatctgtatgaccaagaggcaggggcggtggcttccttaatg
aaggaattgaaccaaacgggcgaatatcaagttaccgacgaagttttaaagcgtctgcac
caagattttgtcgctgattgggccagtgaagaagaaattagcgaagagattcgacggatc
tatttggcagctgactacgtcattgacccccacacggccgtgggttcggtggtggcgcac
cgatataaagaacggacgggggataacaccccgatggtggtggtcgccaccgctagcccc
tacaagtttgccgaaacggtctacccggcggtaacgggaaaggaaacggcggcgcgcggg
ctgcaagcaattcaagggctcaacgaattcttaggtgaggagttaagcccgggggtcaag
gccctgtttgaaggggaccaacgctcagaacagcgggtggaaccaagtgagatggcccaa
ctaattgaaaaacggctcggcttaacgagtgagcaaaaggaataa

DBGET integrated database retrieval system