KEGG   Lactobacillus fermentum CECT 5716: LC40_0744Help
Entry
LC40_0744         CDS       T01958                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lfr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lfr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:lfr00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1319263..1320807)
Genome map
AA seq 514 aa AA seqDB search
MRSFFYYGREITCNTEAPATKRXKQMTAPEAILQGLAPDGGLFVPQSFPQPDYDLGALVN
APYQEVATTIWGWFFDDFSLASRQAIVRGAYGEQWDDSQIAPLSERVAGNYYLELFHGPT
LAFKDVALQALPRLMKEAVTVTGDDKQIIILTATSGDTGSAAMRGFSDVTGTQVVVFYPD
GGVSPVQLRQMLAMKGDNLAAVAVAGNFDDAQTEVKKIFNDQEFAARLAQAGDRFSSANS
MNIGRLIPQLTYYFTAYGQLVKRGEVELGAPVNFAVPTGNFGDILAGYYAKKLGLPIKKL
LCASNQNRVLTDFFATGHYDRRRPFHLTTAPAMDILVSSNLERLLFDLYDQEAGAVASLM
KELNQTGEYQVTDEVLKRLHQDFVADWASEEEISEEIRRIYLAADYVIDPHTAVGSVVAH
RYKERTGDNTPMVVVATASPYKFAETVYPAVTGKETAARGLQAIQGLNEFLGEELSPGVK
ALFEGDQRSEQRVEPSEMAQLIEKRLGLTSEQKE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagatcatttttttattacgggagggagatcacatgcaataccgaagcacccgcgacc
aagcggcycaagcaaatgacggcgcccgaggcgattttacaggggttagccccggacggg
ggcctctttgtgccccagtcgtttccccaaccagactacgacctgggggccctcgttaac
gccccctatcaagaggtcgccaccaccatttggggctggttttttgacgacttttcgctg
gcgagccgtcaagcaattgtccggggggcctatggtgagcagtgggatgattcccagatt
gcacccctaagcgagcgggtggcggggaattattacttagaactcttccacggcccaacg
ctggcttttaaggacgttgccttacaagcccttccccggttgatgaaggaggcggtcacg
gtgaccggtgatgataaacaaatcatcattttgacggccacttccggtgacactggctcg
gcggcgatgcggggctttagtgacgttaccgggacccaagtagttgttttttacccggac
ggtggggtgagcccagtccaactgcgtcaaatgctagcgatgaagggggataacctggcg
gccgtagcggtggccggcaatttcgatgacgcccaaaccgaggttaaaaagatctttaac
gaccaagaatttgccgctcggttagcccaggcgggcgaccgcttttcgtcggcgaactcg
atgaacattggccggctgattccccagcttacttattacttcaccgcttatggccagttg
gtcaagcgcggggaagttgaactcggcgccccggttaactttgccgtgccaaccgggaac
tttggggatatcctcgccggttactacgctaaaaaattaggtctgccgatcaaaaagctc
ctgtgcgcctccaaccaaaaccgggtcctgaccgacttttttgcgaccggccactatgac
cggcgccgccccttccacctcaccacggccccggcaatggacatcctagtttccagtaac
ttagagcgcctcttgtttgatctgtatgaccaagaggcaggggcggtggcttccttaatg
aaggaattgaaccaaacgggcgaatatcaagttaccgacgaagttttaaagcgtctgcac
caagattttgtcgctgattgggccagtgaagaagaaattagcgaagagattcgacggatc
tatttggcagctgactacgtcattgacccccacacggccgtgggttcggtggtggcgcac
cgatataaagaacggacgggggataacaccccgatggtggtggtcgccaccgctagcccc
tacaagtttgccgaaacggtctacccggcggtaacgggaaaggaaacggcggcgcgcggg
ctgcaagcaattcaagggctcaacgaattcttaggtgaggagttaagcccgggggtcaag
gccctgtttgaaggggaccaacgctcagaacagcgggtggaaccaagtgagatggcccaa
ctaattgaaaaacggctcggcttaacgagtgagcaaaaggaataa

DBGET integrated database retrieval system