KEGG   Lactobacillus fermentum CECT 5716: LC40_0825Help
Entry
LC40_0825         CDS       T01958                                 

Definition
(GenBank) Glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
lfr00010  Glycolysis / Gluconeogenesis
lfr00052  Galactose metabolism
lfr00500  Starch and sucrose metabolism
lfr00520  Amino sugar and nucleotide sugar metabolism
lfr00521  Streptomycin biosynthesis
lfr01100  Metabolic pathways
lfr01110  Biosynthesis of secondary metabolites
lfr01120  Microbial metabolism in diverse environments
lfr01130  Biosynthesis of antibiotics
lfr01200  Carbon metabolism
Module
lfr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC40_0825
   00052 Galactose metabolism
    LC40_0825
   00500 Starch and sucrose metabolism
    LC40_0825
   00520 Amino sugar and nucleotide sugar metabolism
    LC40_0825
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LC40_0825
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LC40_0825
Enzymes [BR:lfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LC40_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FUN14
Motif
Other DBs
NCBI-ProteinID: ADJ41419
UniProt: D8IIE0
Position
complement(1463308..1464270)
Genome map
AA seq 320 aa AA seqDB search
MTNKKLIGVDLGGTTIKFAILTAEGEIQQKWSLRTNILDEGSHIVPDIIDSINHHIDLYK
MSKDQFIGIGMGTPGTIDLAKGTVKGAYNLNWKTTQNVKDQIEEGTGLKFALDNDANVAA
LGERWKGAGNDGDDVAFITLGTGVGGGLIANGELIHGLGAGGEVGHMIVQPNGYLCTCGN
HGCLEQYASATGVVHIAQDKAEEYEGNSRLKAMIDNGDEITSKIVFDLAKENDFLGNEVV
NQVAFYLGLACANLADALNPEFLVIGGGVSAAGDFLLKRVEKNFQEFAFPTVRTTTQLKL
AELGNDAGVIGAASLARRFA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaagaagctgattggtgttgacttaggtgggacgacgattaagttcgctatc
ctgacggctgaaggggaaatccaacaaaagtggtcacttcggactaacattttggatgaa
ggttcccacattgtgccggacattattgactccatcaaccaccacatcgacctttacaag
atgagtaaggatcaattcatcgggatcgggatggggacgcccgggacgatcgacctggca
aaggggaccgttaagggtgcttacaacctgaactggaagacgacgcaaaacgtcaaggac
caaatcgaagaaggtaccggcctgaagtttgccctggacaacgacgccaacgtagcggcc
ctcggtgaacgctggaagggtgccggtaacgatggtgacgacgtggccttcatcaccctg
gggaccggggtcggtggtggcttgatcgccaatggtgaattgatccacgggctgggtgcc
ggtggtgaagttggccacatgatcgttcaaccgaacggttacctttgtacctgtgggaac
cacggttgcttagaacaatacgcttcggcaaccggggtggttcacattgcccaagacaag
gcggaagaatacgaaggtaattctcgcttgaaggcgatgatcgataacggggatgaaatt
acctctaagatcgtctttgacctggccaaggaaaacgacttcttaggtaacgaagttgtt
aaccaagtggccttctacctgggtctggcatgcgctaacttagccgacgccttgaaccca
gaattcctggtaatcggtggtggggtttccgctgccggtgacttcttgctcaagcgggtg
gaaaagaacttccaagaatttgccttcccaaccgttcggacgacgacccaacttaagtta
gccgaattaggtaacgacgctggggtgatcggggcggcttccttggcacgccggtttgca
taa

DBGET integrated database retrieval system