KEGG   Lactobacillus fermentum CECT 5716: LC40_0852Help
Entry
LC40_0852         CDS       T01958                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
lfr00790  Folate biosynthesis
lfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LC40_0852
Enzymes [BR:lfr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LC40_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind SPOB_ab DUF1611_N ComZ
Motif
Other DBs
NCBI-ProteinID: ADJ41441
UniProt: D8IIG2
Position
complement(1515976..1517109)
Genome map
AA seq 377 aa AA seqDB search
MKISIKMPTTTDAFNQAVLAQLATVEEQRFLFWQVDQAQQGAVIELIERLDVPFASQADG
IALMVKQAALPVLVKWAKQAWPADDELQSSLEALTKETAILWRAGRFTFNVTAHPLVYGI
LNVTPDSFYDGGRYQATDDVKAHIDQMVKDGADIIEVGGQTTKPGGFVEVSPDEEIKRIT
PAIEYLKANYPAVAIAVDTYKYPVMQAAVELGVDIINDVNAFLDDDQKLTLLKDSQVGLV
TMHSSREHEYENLTVAMKHFFEENLAMLEKAGIDRERVLLDQGIGYSKVADGEQDYAMMR
NLDQFNYLKRPMIVAISRKGFGKQLFGLAKDDRLDVTLIAESYMYLHGGRVLRVHDVKET
KQLVKMLDTITSGYWQL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatttcaattaagatgccaaccaccacggacgcctttaaccaggcggtgctagcg
caactggccacggtggaagaacagcgctttttgttttggcaagtcgaccaagcacagcag
ggcgccgttattgaattaatcgaacgtttagacgtcccgtttgctagccaagcagacggg
atcgccctaatggtcaagcaggccgccttaccagtgttggtcaagtgggctaagcaagcc
tggccagccgatgacgaactccaaagctccttagaggcgctcactaaggaaacggcgatc
ttatggcgggccggtcggttcacctttaacgtcaccgcccaccccttggtttacgggatc
ttaaacgtgacgccggactccttttatgacggcggacgctaccaagcaaccgacgacgtc
aaggcccacatcgatcagatggtcaaggatggcgccgacatcattgaggttggtggccaa
acgaccaagcccggtggctttgtggaagtaagtcccgacgaagaaatcaagcggatcacc
ccggccatcgagtacttaaaggctaactacccggcggtggcaattgccgtggatacctac
aagtacccggtcatgcaagcggccgtggaactaggggtggacatcattaacgacgtcaac
gcttttttggatgacgatcagaagttaaccctgctaaaagatagccaggttggcctggtg
acgatgcactcgagccgggaacacgaatacgaaaacctgacggtggcgatgaagcacttc
ttcgaggagaacctggcgatgctagaaaaggccggtatcgaccgggagcgggttcttttg
gatcaggggattggctactccaaggttgccgacggggaacaagactacgccatgatgcgc
aacctcgaccagttcaactatttgaagcggccgatgatcgtggcgatctcgcgcaagggc
tttggtaagcaactctttggtctggccaaagacgatcgcctagacgtgaccctaattgcc
gaaagttacatgtacctgcacggcgggcgggtgctacgggtccacgacgtcaaggagacc
aagcagttagtaaagatgctcgacacgattaccagtggttactggcaactgtaa

DBGET integrated database retrieval system