KEGG   Lactobacillus fermentum CECT 5716: LC40_0852Help
Entry
LC40_0852         CDS       T01958                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lfr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1515976..1517109)
Genome map
AA seq 377 aa AA seqDB search
MKISIKMPTTTDAFNQAVLAQLATVEEQRFLFWQVDQAQQGAVIELIERLDVPFASQADG
IALMVKQAALPVLVKWAKQAWPADDELQSSLEALTKETAILWRAGRFTFNVTAHPLVYGI
LNVTPDSFYDGGRYQATDDVKAHIDQMVKDGADIIEVGGQTTKPGGFVEVSPDEEIKRIT
PAIEYLKANYPAVAIAVDTYKYPVMQAAVELGVDIINDVNAFLDDDQKLTLLKDSQVGLV
TMHSSREHEYENLTVAMKHFFEENLAMLEKAGIDRERVLLDQGIGYSKVADGEQDYAMMR
NLDQFNYLKRPMIVAISRKGFGKQLFGLAKDDRLDVTLIAESYMYLHGGRVLRVHDVKET
KQLVKMLDTITSGYWQL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatttcaattaagatgccaaccaccacggacgcctttaaccaggcggtgctagcg
caactggccacggtggaagaacagcgctttttgttttggcaagtcgaccaagcacagcag
ggcgccgttattgaattaatcgaacgtttagacgtcccgtttgctagccaagcagacggg
atcgccctaatggtcaagcaggccgccttaccagtgttggtcaagtgggctaagcaagcc
tggccagccgatgacgaactccaaagctccttagaggcgctcactaaggaaacggcgatc
ttatggcgggccggtcggttcacctttaacgtcaccgcccaccccttggtttacgggatc
ttaaacgtgacgccggactccttttatgacggcggacgctaccaagcaaccgacgacgtc
aaggcccacatcgatcagatggtcaaggatggcgccgacatcattgaggttggtggccaa
acgaccaagcccggtggctttgtggaagtaagtcccgacgaagaaatcaagcggatcacc
ccggccatcgagtacttaaaggctaactacccggcggtggcaattgccgtggatacctac
aagtacccggtcatgcaagcggccgtggaactaggggtggacatcattaacgacgtcaac
gcttttttggatgacgatcagaagttaaccctgctaaaagatagccaggttggcctggtg
acgatgcactcgagccgggaacacgaatacgaaaacctgacggtggcgatgaagcacttc
ttcgaggagaacctggcgatgctagaaaaggccggtatcgaccgggagcgggttcttttg
gatcaggggattggctactccaaggttgccgacggggaacaagactacgccatgatgcgc
aacctcgaccagttcaactatttgaagcggccgatgatcgtggcgatctcgcgcaagggc
tttggtaagcaactctttggtctggccaaagacgatcgcctagacgtgaccctaattgcc
gaaagttacatgtacctgcacggcgggcgggtgctacgggtccacgacgtcaaggagacc
aagcagttagtaaagatgctcgacacgattaccagtggttactggcaactgtaa

DBGET integrated database retrieval system