KEGG   Lactobacillus fermentum CECT 5716: LC40_0999Help
Entry
LC40_0999         CDS       T01958                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LC40_0999
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC40_0999
  Lipid metabolism
   00071 Fatty acid degradation
    LC40_0999
  Amino acid metabolism
   00350 Tyrosine metabolism
    LC40_0999
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LC40_0999
   00626 Naphthalene degradation
    LC40_0999
Enzymes [BR:lfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LC40_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1790301..1791335)
Genome map
AA seq 344 aa AA seqDB search
MSEQIPEQMRAWAVKVPAPIESDPCPLQLVKKPVPTPAPGEVLVKVLACGVCHTDLHVTE
GDLPVHQPEVTPGHEIVGRVVASGASTQRFAIGDRIGIPWFRHACGVCRYCRSGHENLCS
HSLYTGWDHNGGYAEYVTVPEGFAYRIPARFKDVEAAPLLCAGIIGYRALLRANVPAGGR
LGLYGFGGSAHLAAQLAIKQGIEVHVFTRGKDAQKFALELGCASAQGAYDRAPVPLDSAI
MFSPAGAMVPNALANLAPNGTLALAGIHLSDVPSLNYQDHLFHEKTVTSVESNTRRDGEE
FLTLADRLGITPTVTAVPFNQADQALKRVSRGNIDGAYVLEMPS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaacaaattcctgaacaaatgcgggcctgggcggtaaaagtccccgccccgatt
gaaagtgatccctgtcccctgcaattggttaaaaaaccggtgccgaccccggcgcccggc
gaggttttggttaaggttttggcctgtggggtctgccacactgacttacacgtgacggaa
ggcgacctccccgtccaccaaccggaagtcaccccgggccacgaaatcgtcggccgggtg
gtcgctagtggagctagcacccagcgtttcgccattggtgaccggatcgggattccctgg
ttccgccacgcctgtggggtctgccgttattgtcgcagtggacacgaaaatctgtgttcc
cactcgctgtacaccggctgggatcacaacgggggctacgccgagtacgtaacggtaccg
gagggctttgcctaccggattcccgcccgctttaaggacgtggaagcggcgcccctacta
tgcgccgggatcattggttaccgggcgctcttgcgggctaacgtaccggcggggggccgt
ttgggactgtatggctttggtggctccgcacacctggcggctcagttagcgattaagcag
gggatcgaggtgcacgtctttacccggggcaaggacgcccaaaagtttgccctggagttg
ggctgtgcctcagcgcaaggggcctatgaccgagcaccggtcccgcttgattcggccatt
atgttttcgccagcgggggccatggtgcctaacgccttggctaacctggcccccaacggg
acgctggccttagccggaatccacttgagtgacgtccccagcttaaattaccaggaccac
ctctttcacgaaaaaacggtcactagcgtcgaatctaacacccgccgcgatggtgaggag
ttcttgaccctggcggatcggttggggatcacgccaacggtcacggcggtaccatttaac
caggctgaccaggctctgaaacgggttagcagaggaaatattgacggcgcttacgtgctt
gaaatgccgtcataa

DBGET integrated database retrieval system