KEGG   Lactobacillus fermentum CECT 5716: LC40_1035Help
Entry
LC40_1035         CDS       T01958                                 

Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC40_1035
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LC40_1035
Enzymes [BR:lfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     LC40_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1853573..1853791)
Genome map
AA seq 72 aa AA seqDB search
MAVHFDLDALLPTAFRSIYPAEPGTDPADFPATVGQLTLPEVANLLTQLDQNAELVGLTV
AEHMAWDALNLR
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
gtggccgttcactttgacctcgacgccttgttgcccacggcttttcgctcaatttacccg
gccgaaccagggaccgacccggcggacttcccggccaccgtgggccaattaaccttgcca
gaagtggcgaacctgttgacccagctcgatcaaaacgccgaactggtcggcttgacggtg
gccgagcacatggcctgggacgcgctcaatttacgctag

DBGET integrated database retrieval system