KEGG   Lactobacillus fermentum CECT 5716: LC40_1035Help
Entry
LC40_1035         CDS       T01958                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
lfr00220  Arginine biosynthesis
lfr00330  Arginine and proline metabolism
lfr01100  Metabolic pathways
lfr01110  Biosynthesis of secondary metabolites
lfr01130  Biosynthesis of antibiotics
lfr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    LC40_1035
   00330 Arginine and proline metabolism
    LC40_1035
Enzymes [BR:lfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     LC40_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADJ41599
UniProt: D8IIX0
Position
complement(1853573..1853791)
Genome map
AA seq 72 aa AA seqDB search
MAVHFDLDALLPTAFRSIYPAEPGTDPADFPATVGQLTLPEVANLLTQLDQNAELVGLTV
AEHMAWDALNLR
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
gtggccgttcactttgacctcgacgccttgttgcccacggcttttcgctcaatttacccg
gccgaaccagggaccgacccggcggacttcccggccaccgtgggccaattaaccttgcca
gaagtggcgaacctgttgacccagctcgatcaaaacgccgaactggtcggcttgacggtg
gccgagcacatggcctgggacgcgctcaatttacgctag

DBGET integrated database retrieval system