KEGG   Lactobacillus fermentum CECT 5716: LC40_1108Help
Entry
LC40_1108         CDS       T01958                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lfr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LC40_1108
Enzymes [BR:lfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LC40_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981543..1982490
Genome map
AA seq 315 aa AA seqDB search
MTHDITVIGSNMMELTTDIDRMPKLGETVSAPSFHMAFGGKGANQAYAAAQLGSSVAMIS
KVGSDSLGQAYLEHFQQSGIDITGVSVGNQSNGVAPCFIQGNMNSIIVVQGANSELTPDV
LDQYTDLIKSSKMVILQQEISLATDYRAIDLAEQFHVPVMLNPAPANDNVDLEHITKCEF
YSPNETELGRLTHLPVESIDQIKDAAHSLVDQGVKNVIVTIGSRGALWVCADHEELIPSY
KVNAVDSIGAGDSFVGAFAHYYTNGEDIPTALRHANAYAAVTVTMSGSQTSYPSAAELPQ
LQEQLGITVDPTQLA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgatattactgtaattggctccaacatgatggaattaacgaccgatattgac
cgcatgcctaagttaggggaaactgttagcgccccaagttttcacatggcctttggggga
aagggggctaaccaagcttacgccgccgctcaactaggctcctcagtggccatgatttca
aaggtgggctccgacagtcttggtcaagcctacttggaacacttccaacagagcggcatt
gacattacgggcgttagcgtcggtaaccaaagtaatggagtggcgccatgcttcatccaa
ggcaatatgaacagtatcatcgtggttcaaggggctaacagtgagttaacgccagacgtt
cttgatcaatacaccgatctcatcaaaagctccaaaatggttatcttgcaacaagagatt
tcgctggcaacggactaccgagccattgacctagctgaacaattccatgttccggtgatg
ctaaacccagctcccgcgaatgataacgttgacttagaacacatcaccaagtgcgagttt
tactctccaaacgaaacggaactcggtcgtctcacccacctaccggtagaatctatcgac
caaattaaagacgctgcccattcccttgttgaccaaggggttaaaaacgtaatcgtcaca
atcggaagtcgaggagcactctgggtttgtgcggatcatgaagagctcatcccctcttac
aaagtcaatgccgttgactccatcggggctggcgactcattcgtgggggcctttgcccac
tactacacgaatggtgaagacatcccaactgctttaaggcacgccaacgcctacgccgcc
gttaccgtaacgatgtccggaagccaaacctcgtacccatccgcagccgaattacctcag
ctacaagagcaactgggcatcaccgtcgacccgactcaacttgcttaa

DBGET integrated database retrieval system