KEGG   Lactobacillus fermentum CECT 5716: LC40_1129Help
Entry
LC40_1129         CDS       T01958                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lfr  Lactobacillus fermentum CECT 5716
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lfr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lfr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lfr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2023905..2026127)
Genome map
AA seq 740 aa AA seqDB search
MPIKYHQKSREFHLYNNQISYIIKILRNDQLGQLFFGQRVPDRANHDYLVENTYRPVTLY
VDDNNYSFSLGNLKQEYPTYGTTDYRIPAFEVKQPNGSTITNFKYVSHKIFPGKPQLDNL
PATYTEDDSEATTLEILLHDSLINVDLVLRYTIFNNYNAIARSVKFINHSENSYQLTTAM
SLNLDLPDDNYDWLQFSGAWGRERQLKAAHLRPGIQAVDSTRGASSHMENPFIILKRPHT
DDFQGEAYGFSLIYSGNFLAQAEVDPYKVTRVQIGINPFHFSWKLNPQQSFQTPEAVMVY
THNGLNDLSQNFHRLYQQRLVRGYWRDRQRPILINNWEATYFDFTEEKLLALAKTAKNLG
IELFVLDDGWFGKRTTETAGLGDWWVNRDRLPDGISGLSAKIHDLGMMFGLWFEPEMTNK
DSDFYRQHPDYIIETPKRHASQGRKQYVLDFSRPEVVDYVYQLMAKVLREGKVDYVKWDM
NRNITECFSTAYPADQQGEIFHRYILGVYHLYDRLIHEFPKILFESCASGGGRFDAGMLY
YAPQAWTSDDSDAIERLKIQTGTSYCYPISSMGAHVSVSPNEQLQRQTPLKTRADVAYFG
AFGYELDLNTLSPEELAQVKRQIVFMKEHRQLFQFGTFYRLKTPFESNIVAWLVVSPDKK
HAIMGYFKILNDVNAEYRLQRIPGLDPLAEYHVKEEAGNIIGSFSGSELAKIGLVTTDAS
AGENKETTDFYSKLFTFDAQ
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcctattaagtatcaccaaaagagtcgtgaatttcacctatacaataatcagataagt
tatattatcaagatccttcgtaacgaccagttagggcagcttttctttggtcaacgtgtt
cccgaccgtgctaatcatgattatttagttgaaaatacgtaccggccagttactttatac
gtggatgataacaattattctttttcattaggtaatttaaaacaagaatatcctacttat
gggacaactgactaccgtatacctgcctttgaagttaaacaaccaaatggcagcactatt
actaattttaaatatgtatcgcataaaattttccctggaaagccacaactcgacaactta
cccgctacctataccgaagatgacagtgaagcaaccactctcgaaatactccttcatgac
tcccttattaatgtcgacctcgtcctaagatatactatcttcaataattacaacgcgatt
gctcgtagtgttaaatttatcaatcatagtgaaaattcttatcaactaacaaccgccatg
agcttaaatcttgatttgccagatgacaattatgattggttacagttttctggagcatgg
ggacgtgaacgacaattaaaagctgcccaccttcgtccaggtattcaagcagttgacagt
accagaggcgcttctagtcacatggaaaatccatttattattttaaaaaggccccacact
gatgattttcagggtgaagcatatggcttttctttaatttatagtgggaattttcttgcc
caggctgaagttgatccttataaagttacgcgagttcagattggtatcaacccattccat
ttttcatggaaacttaatccgcaacaatctttccaaactccagaagccgtaatggtttat
acccataacgggcttaatgatctcagtcaaaacttccaccggctctatcaacaacgatta
gttcgcggatattggcgagaccggcaacgaccaatccttatcaataactgggaagcaacc
tactttgattttactgaggaaaaattgctagctctcgccaagaccgccaagaatttaggg
attgaacttttcgtccttgatgacggctggtttggtaaacgaacaactgaaacagccggt
ttaggtgactggtgggttaatcgagatcgtctcccagatggaattagtggcttatcagct
aagatccatgatttaggaatgatgtttggcctctggtttgaaccagaaatgaccaataaa
gatagtgacttttatcgtcagcatccagattatattattgagactcctaaacgacatgca
tcacaggggcgaaagcaatacgtccttgacttctcacgaccagaagtagtggattatgta
tatcaattaatggcaaaagttttacgtgaaggcaaggttgattacgtgaagtgggatatg
aatcgtaatattactgagtgcttttcaactgcataccctgctgatcaacaaggcgaaatt
ttccaccgttatattttaggcgtttaccatctttacgaccgcttaattcatgaattcccg
aaaattttatttgaatcttgtgctagtggcggtggtcgttttgacgccggaatgctttac
tacgctcctcaagcttggacaagcgatgattctgatgcgattgaacgtttaaaaattcaa
actggaacatcatattgttaccctatcagctcaatgggcgctcatgtctcggtctcacca
aatgaacaattacaacgacaaaccccgcttaaaacccgtgctgatgtcgcctactttggt
gcatttggttatgaattagacctaaatactttatcgccagaagaattagcccaagttaaa
cggcagattgtctttatgaaagagcatcgacaacttttccaatttgggactttctaccgt
ctaaaaacaccttttgaaagtaatattgtcgcctggctggttgtctctcccgataaaaag
catgcgattatgggatactttaagattcttaatgacgtcaatgcggaataccgcctacaa
cgcattcctggcctagatcctttagcagaataccatgttaaagaagaagctggtaatatc
attggctcctttagtggcagtgaacttgcaaagatcggtctcgttactactgacgcctca
gctggtgaaaataaggaaactactgatttttatagtaagttatttacctttgacgcgcaa
taa

DBGET integrated database retrieval system