KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0167Help
Entry
LGAS_0167         CDS       T00410                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LGAS_0167 (gpmA)
   01230 Biosynthesis of amino acids
    LGAS_0167 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGAS_0167 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LGAS_0167 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGAS_0167 (gpmA)
Enzymes [BR:lga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LGAS_0167 (gpmA)
Exosome [BR:lga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LGAS_0167 (gpmA)
  Exosomal proteins of melanoma cells
   LGAS_0167 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
201543..202235
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKATAEKYGDEQVHIWRRSYDVL
PPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVCLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMNLEMKTGEPVVYTFDDKLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattagttttaattcgtcacggtcaaagtgaatggaacctttctaaccaattt
actggttgggttgatgtaaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaattaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcacttgaagaaagtgaccaactttggattccagaaact
aagacttggagattaaatgaacgtcattacggtgctcttcaaggtttaaacaagaaggct
actgctgaaaaatacggtgacgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgatgacaacgaatttagtcaagcacatgaccgtcgttacgcaaac
ttggatccacacatcgttcctaaggcagaaaacttacacgtatgtcttgatcgtgtaatg
ccattctgggaagatcacattgctccagatttacttgacggcaagaacgttattattgct
gcacatggtaactcacttcgtgctttaactaagtacattgaaaacatctcagatgatgac
atcatgaacttagaaatgaagactggtgaaccagttgtttacacatttgacgacaagtta
gatgttgttaacaaagaaaagcttgacgactaa

DBGET integrated database retrieval system