KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0167Help
Entry
LGAS_0167         CDS       T00410                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga00010  Glycolysis / Gluconeogenesis
lga00260  Glycine, serine and threonine metabolism
lga00680  Methane metabolism
lga01100  Metabolic pathways
lga01110  Biosynthesis of secondary metabolites
lga01120  Microbial metabolism in diverse environments
lga01130  Biosynthesis of antibiotics
lga01200  Carbon metabolism
lga01230  Biosynthesis of amino acids
Module
lga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lga_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGAS_0167
  Energy metabolism
   00680 Methane metabolism
    LGAS_0167
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGAS_0167
Enzymes [BR:lga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LGAS_0167
Membrane trafficking [BR:lga04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LGAS_0167
Exosome [BR:lga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LGAS_0167
  Exosomal proteins of melanoma cells
   LGAS_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ABJ59579
JGI: LGAS0167
Position
201543..202235
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKATAEKYGDEQVHIWRRSYDVL
PPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVCLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMNLEMKTGEPVVYTFDDKLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattagttttaattcgtcacggtcaaagtgaatggaacctttctaaccaattt
actggttgggttgatgtaaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaattaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcacttgaagaaagtgaccaactttggattccagaaact
aagacttggagattaaatgaacgtcattacggtgctcttcaaggtttaaacaagaaggct
actgctgaaaaatacggtgacgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgatgacaacgaatttagtcaagcacatgaccgtcgttacgcaaac
ttggatccacacatcgttcctaaggcagaaaacttacacgtatgtcttgatcgtgtaatg
ccattctgggaagatcacattgctccagatttacttgacggcaagaacgttattattgct
gcacatggtaactcacttcgtgctttaactaagtacattgaaaacatctcagatgatgac
atcatgaacttagaaatgaagactggtgaaccagttgtttacacatttgacgacaagtta
gatgttgttaacaaagaaaagcttgacgactaa

DBGET integrated database retrieval system