KEGG   Lactobacillus gasseri: LGAS_0257Help
Entry
LGAS_0257         CDS       T00410                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lga  Lactobacillus gasseri
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LGAS_0257
  Lipid metabolism
   00561 Glycerolipid metabolism
    LGAS_0257
   00600 Sphingolipid metabolism
    LGAS_0257
Enzymes [BR:lga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LGAS_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
289414..291645
Genome map
AA seq 743 aa AA seqDB search
MIDVIDNKYFYLHNGAVAYLFGLLPNHQLEHLYYGEDLGELSKNDLEYMSLHPNKASGTV
KYSKKIKNFTLADRMQEFPTYGTSDFREGAVSIENEGAYLYPDFKYDHFEITTGKKRNLD
FPTSYGNDSENLIVSLIDTDHQLELQLSYSIFENWSAIVRKATIINHGKQEVKLTNLQST
VLDLPNDSYDFLQLSGAWTKERHITTRPLTQGITKIESLRGASSHQENPFIALVDKNVTN
DSGNIYASNLIYSGNFISQVEVDEWGQSRLMTGINPATFKWKLAPNQDFSTPEAVLFYSK
QGFNGLMKQTHNFVKKHIIDQKWQQRDRLIVINNWEATYFDFNEEKLLKLAAQANQLGIE
CFVLDDGWFGKRDSDNSSLGNWTVDKRKFPQGLDHFSAQVHKMGMKFGLWFEPEMVSADT
ELYNMHPDWVVRHPYKRYSVGRRQYVLDFANPAVVDNIYQQMAKIIEDAQVDYIKWDMNR
NITEAYSPYLYSINHPQGEIFHRYIQGVYKLYAKLLTSFPDLLIEGCASGGGRFDLGILY
YSPQIWPSDDSDAVERLDIMSGTLLAYPLSTFSNHVSAVPNDQVKRITSLKFRQNVACFG
PLGYELDLNKLSTEEKNQIKNWIRWYKENRKLLVNGTFDQLLKFDPSQNTYAWSVSNSNK
QIVGFYRKLARPNETLDQYLPLKHLNDHQKYQINFDQMVSGRVLQKFGLREPYQFNASNP
DTAQISGDFQSYLYQIKTIDRKI
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtaattgataataaatatttttatttacataatggtgcagtcgcatactta
tttggattgttgcctaatcaccaattagagcacttatattatggtgaagatttaggtgaa
ttatctaagaacgatttagaatatatgtcgcttcatccaaataaagcttctggaacagtg
aaatattcaaaaaaaattaaaaattttacactcgctgatcgaatgcaggaattcccaacg
tacggtacaagcgattttcgtgagggtgctgtaagtattgaaaatgagggcgcgtatcta
tatcctgattttaaatacgatcattttgagattacgacaggtaagaaaagaaacttagat
tttcctacttcatatggaaatgatagtgaaaatttaattgtctccttaattgatactgat
caccagttagaattgcaactttcatatagtatttttgaaaactggtcggcaatagtgcgt
aaggcaacgattattaatcatggtaagcaagaagttaaacttactaacttgcaaagtaca
gttctcgatttgccgaatgatagttatgattttctgcaattatctggagcttggactaaa
gagcggcatattacaacccgtccgttaacgcaaggaattactaaaattgaatcgttaaga
ggcgcgtcaagccatcaagaaaatccttttattgcacttgtggataagaatgtgacaaat
gacagtggaaatatatatgcaagtaatttaatttattctggcaattttattagccaagtg
gaagttgatgaatggggacaaagtaggttgatgaccggaatcaatccagctacttttaag
tggaaattggcaccaaatcaggatttttctacaccagaagctgtcttgttttacagtaag
caaggctttaacggcttaatgaagcagacgcataattttgttaaaaaacatattattgat
caaaaatggcaacaacgagatagactaattgtaattaataattgggaagctacttatttt
gacttcaatgaagaaaagctgctgaaattggcagctcaggctaaccaactaggaattgag
tgttttgttcttgatgatggatggtttggtaaacgagatagtgataacagttcattagga
aattggacagtggataaaagaaagtttccacaaggattggatcatttcagtgcacaggtg
cataaaatggggatgaaatttggcttatggtttgaaccagaaatggtttcagcagatact
gaactatataatatgcatcccgactgggttgttagacatccttacaagcgttattcagtt
ggacgcagacaatatgtacttgattttgcaaatccagcagtggtagataatatctatcag
cagatggctaaaataattgaagatgctcaagtagactatattaaatgggatatgaatcga
aatattactgaggcatattcgccgtatttgtattctattaatcatccccaaggtgaaatt
ttccacagatatattcaaggtgtttataagttatacgcaaagttattaacaagttttcct
gacctgttaattgaaggttgcgctagtggtggcggacgctttgatttaggaattctatat
tatagtccacaaatttggccaagtgatgacagtgatgcagtagaaagattagatattatg
tcaggaaccttgttggcgtatcctttatctacgtttagtaatcatgtttctgctgttcct
aacgatcaagtaaaaagaataacaagcttaaaatttagacaaaatgttgcttgctttggt
cctttaggatatgagttagacctaaataagttatcaacagaagaaaagaaccaaattaaa
aattggattagatggtataaagaaaatcgtaaattgttggtcaatggaacttttgatcaa
ctattaaaatttgatccctcacaaaatacttatgcttggagtgtaagcaattctaataaa
cagattgtcggattttatcgcaaacttgcgcgacctaatgaaactttagatcagtatctc
cctcttaaacatttaaatgatcatcaaaaatatcaaattaattttgatcagatggtatcg
ggtagagttttacaaaaatttggattacgtgaaccatatcaattcaatgcttcaaatcct
gacactgcgcaaattagtggtgactttcaatcgtatctttatcaaataaaaactattgac
agaaaaatctaa

DBGET integrated database retrieval system