KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0332Help
Entry
LGAS_0332         CDS       T00410                                 

Definition
phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LGAS_0332
   01230 Biosynthesis of amino acids
    LGAS_0332
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGAS_0332
  Energy metabolism
   00680 Methane metabolism
    LGAS_0332
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGAS_0332
Enzymes [BR:lga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LGAS_0332
Exosome [BR:lga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LGAS_0332
  Exosomal proteins of melanoma cells
   LGAS_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
356202..356891
Genome map
AA seq 229 aa AA seqDB search
MVRNLVKLVLVRHGESIANRDNVYTGWNDVPLSKKGIEQAKDAGLKVAKIPDFVPTHIHT
SVLSRAIMTANIIADVCSFLYLPITKTWRLNERHYGALRGINKDVSKKIFGKEQVLKWRR
GFDSVPPLLTQPVQDRRYQKYDMRLMPQGESLHQTQDRLMPYFWDHIAPELMSGHDQLIV
AHGSSLRALIKKIEGISNKDIVKVEVPNAEPIVYTFDSDLHIIKKEILH
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagaaatttggttaagttggttttagttcgacacggagaaagcatagcaaatcga
gataatgtatatactggctggaatgacgtgccgttgagtaaaaaaggaattgaacaagct
aaagatgcagggctcaaagtagctaagattcctgattttgtacctactcatatccacact
tctgttctgtcacgtgcaattatgactgcaaatataattgcggatgtttgtagttttctc
tatttaccaattactaaaacttggcgcttaaatgaaagacactatggagctttaagaggc
attaataaagatgtttcaaaaaagatctttggtaaagaacaagtattaaagtggaggcgt
ggatttgatagtgtaccaccacttctaactcagcctgttcaagaccgcagatatcaaaag
tatgatatgcgcttgatgccgcagggagaaagtttgcatcaaactcaagaccgattgatg
ccatatttttgggaccatattgcgcctgaattaatgtctggtcacgatcaactaattgta
gctcatggatcaagtctgcgtgcccttattaaaaaaattgagggtatcagcaataaagat
attgtgaaggttgaagttccaaatgcagaaccaattgtttatacttttgattctgacttg
catattattaaaaaagaaattttgcactaa

DBGET integrated database retrieval system