KEGG   Lactobacillus gasseri: LGAS_0337Help
Entry
LGAS_0337         CDS       T00410                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lga  Lactobacillus gasseri
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lga00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LGAS_0337 (gltX)
Enzymes [BR:lga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LGAS_0337 (gltX)
Amino acid related enzymes [BR:lga01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LGAS_0337 (gltX)
Transfer RNA biogenesis [BR:lga03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LGAS_0337 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
361556..363055
Genome map
AA seq 499 aa AA seqDB search
MAKQKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTMVLRIEDTDQKRNVEGGSKSQ
MENLHWLGIDWDEGPDKGGDFGPYRQSERKDIYNKYIKQLIDEGKAYYSYKTEEELEAQR
EEQRAMGIAPHYTYEYEGMTADEIKQAQADAEAKGLKPVVRIHIPENRTYAWDDMVKGKV
SFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMEITHVLRGDDHVANTPKQLVVYEALGW
EPPKFGHMTLIINSETGKKLSKRDESVLQFIEQYRDLGYLPEAMFNFITLLGWSPVGESE
IFSQRELIKSFDPKRLSKSPAAFDQKKLEWINNQYVKKADRDVLLDLALNNLQEAGLVGK
EVSPEKMEWVRQLVNIYAVQMSYTKQIVDITKIFFEEAPELSDAEVEEIKKDDARPVIEE
FKKQLNAIPRFTAVQVMNAIQATRRETGVKGRKLFMPIRIAATRSMVGPGIGEAIELMGK
EKVNKHIDLTLKQLSDLGL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaacaaaaaatccgtgttcgttacgcaccaagtccaacaggtcacttgcatatc
ggtaacgcacgtactgcattatttaactatttatttgcacgtcataacaaagggactatg
gtcttaagaattgaagatactgaccaaaaacgtaacgttgaaggcggttctaagtcccaa
atggagaacttgcactggttaggtattgactgggatgaaggtcctgataagggcggcgac
tttggcccttaccgccaatcagagcgtaaagatatttacaataaatacattaagcaatta
attgacgaaggtaaggcctactattcatacaagactgaggaagaactggaagcacagcgt
gaagaacaacgtgcaatgggaattgctcctcactacacttatgaatacgaaggtatgacc
gctgatgaaattaagcaagctcaagcagatgcagaagcaaaaggcttaaagccagttgtt
cgtatccacattcctgaaaatagaacttatgcttgggatgatatggttaagggtaaagta
tcatttgaatctgatactattggtggcgactttgttatccaaaaacgtgatggcatgcca
acttataactttgccgttgtaattgatgaccacttaatggaaattactcacgttcttaga
ggtgacgaccatgtagctaacactcctaagcaattagtagtttatgaagcacttggctgg
gaaccacctaagtttggtcacatgactttaatcattaactctgaaactggcaagaagctt
tctaagcgtgatgaatcagttcttcaatttattgaacaataccgtgaccttggttacttg
ccagaagcaatgtttaactttattactttgcttggttggtcacctgttggtgaaagtgaa
attttctcacaaagagaattaattaaatcatttgatcctaagcgtttatctaagtcacca
gctgcttttgatcaaaagaagcttgaatggattaataaccaatacgttaagaaagcagat
cgtgatgttttattagatcttgctttgaataacttacaagaagcaggattagttggtaaa
gaagtttcacctgaaaagatggaatgggttcgtcaattggtaaatatttacgctgttcaa
atgtcttacactaagcagatcgttgatattactaagatcttctttgaagaagctccagaa
ttatctgatgcagaagtcgaagaaattaagaaagacgatgctcgtcctgtaattgaagaa
ttcaagaaacaattaaatgcaattcctcgctttactgctgttcaagtaatgaacgcaatt
caagctactcgtcgtgaaactggcgttaagggtagaaaattatttatgccaattcgaatt
gctgctactcgttcaatggttggacctggtatcggtgaagctattgaattaatgggtaaa
gaaaaagttaacaagcacattgatttaactttgaagcaattaagcgatttaggtctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system