KEGG   Lactobacillus gasseri: LGAS_0370Help
Entry
LGAS_0370         CDS       T00410                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lga  Lactobacillus gasseri
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lga03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
389602..390201
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIARLIDNYMKLPGIGEKTATRLAFYTMDMPEDDVEDFSKSLIQVKENLHSCSIC
GNITESDPCEICRDANRDRSTIMVVEQPKDVMAFEEMGEYNGLYHVLHGVLSPMDGVGPE
EINIKSLITRLQKQDEVKEVILALNSSPEGEATAMYLAKLIKPAGLKVTRLAAGLAVGSD
IEYANSITLKRAVQGRTDL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatccattaccaattgcacgtttaattgataattatatgaagttgcctggtatt
ggtgaaaaaacagcaacgcggttagctttttatacaatggacatgcctgaagatgatgtg
gaagacttttccaagtcattaatacaggtaaaagaaaatcttcattcttgttctatttgt
ggaaatattaccgaaagcgatccatgtgaaatttgccgagatgcaaatcgtgatcgctca
acaattatggtagtagaacagccaaaagatgtaatggcttttgaagaaatgggcgaatat
aacggtttataccatgttttacatggtgttctgtccccaatggatggtgttggcccagaa
gaaattaatattaagagcctaattactagactgcaaaagcaagatgaagttaaagaagtt
attttagctttaaattctagcccagaaggtgaagcaactgcaatgtacttagctaagcta
atcaaaccagccggcttgaaagtgacgcgcctagctgcgggattagctgtaggtagcgat
attgaatatgcaaattcaattacgttgaagcgcgctgttcaagggagaacagatctatga

DBGET integrated database retrieval system