KEGG   Lactobacillus gasseri ATCC 33323: LGAS_0414Help
Entry
LGAS_0414         CDS       T00410                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LGAS_0414
Enzymes [BR:lga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LGAS_0414
DNA repair and recombination proteins [BR:lga03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LGAS_0414
    RecFOR pathway proteins
     LGAS_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
441534..442112
Genome map
AA seq 192 aa AA seqDB search
MFEYLKGIVAKIDPAYVVLDVNGIGYKILCPTPYSYQENQPATIYVEQVVRDTGITLYGF
LSLEDKELFLKLLSVSGIGPKSAVAIMAAEDTDSLASAIQNGEVKYLTRFPGVGKKTASQ
IVLDLKGKLGDYVKKSAVATDLTPSLQDALLALVALGYTQKEVDRITPKLAKLPENTADG
YIKEALALLLKK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatctcaaaggaatagtagcaaaaatcgatccagcttatgtagtattagat
gtaaatggcattgggtataagatcctttgtcccactccatatagctatcaagaaaatcag
ccagcaactatctatgttgaacaagttgttagagatacagggattaccttatatggcttt
ttatctttagaagacaaagaattatttttaaaattattaagcgtttcaggaattggacca
aagtcagctgtggcgattatggcggctgaggatacagattcgttagctagcgcaattcag
aatggagaggtgaaatatctaactcgttttccaggggttggaaaaaagactgcttctcag
attgtcttagacttaaagggaaagttaggcgactatgtaaagaaatcagcagttgctacc
gatcttacaccgagcctgcaagatgctttgcttgccttggtagcacttggttatacccaa
aaagaagttgaccgaattactccaaagttagcaaaattgcctgaaaatactgctgatggt
tatattaaagaggctttagctttactacttaagaagtaa

DBGET integrated database retrieval system