KEGG   Lactobacillus gasseri: LGAS_0459Help
Entry
LGAS_0459         CDS       T00410                                 

Gene name
leuS
Definition
leucyl-tRNA synthetase (EC:6.1.1.4)
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
lga  Lactobacillus gasseri
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lga00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LGAS_0459 (leuS)
Enzymes [BR:lga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     LGAS_0459 (leuS)
Amino acid related enzymes [BR:lga01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LGAS_0459 (leuS)
Transfer RNA biogenesis [BR:lga03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LGAS_0459 (leuS)
 Prokaryotic Type
    LGAS_0459 (leuS)
Mitochondrial biogenesis [BR:lga03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LGAS_0459 (leuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
486733..489147
Genome map
AA seq 804 aa AA seqDB search
MYNHKTVEKKWQKYWAEHDTFKTGNDPKKKNYYALDMFPFPSGKGLHVGHPEGYTATDII
SRMKRAQGYNVLHPMGWDAFGLPTEQYALKTGEDPEKVTKENIANFKKQLNKLGFSYDWD
REVTTSDPNYYKWTQWVFEQMYKKGLAYEAEVPVNWSPDLGTVVANEEIVDGKTERGGYP
VYRRNMRQWMLKMTAYADRLLEDLDDLDWPEPVKEMQRNWIGRSEGAQVTFKVKDSDKTF
DVFTTRPDTLFGVSYTVLAPESKLVQEITTPEQKAAVDSYIKKIESKSDLERTDLNKDKT
GVFTGAYAINPVNGKEVPVWISDYVLASYGTGAVMAVPAHDDRDYAFATKFGLPINRVIE
GGDLEKEAFTGNGKHINSDFLDGLDNEEAKKRMIEWLEDHNAGQKKVNYKLRDWDFSRQR
YWGEPIPVIHWEDGTTSLVPEDELPLRLPHATDIKPSGTPESPLANLTDWVNVVDKNGRK
GKRETNTMPNWAGSSWYYLRYIDPHNDKELADYDLLKKWLPVDLYIGGAEHAVRHLLYAR
FWHKVLYDLGVVPTKEPFQRLYNQGLILKNHEKMSKSKGNVVNPDDVIDEYGADSLRMYE
MFMGPLDASIDWDDNGPASTKKFLDRVWRLFVNDLDLKAIPQERIVDKNDGELDKVYAET
VKKVTEDFDALHFNTAISQMMVFINAAQKAKTIPREYAEGFVKLLAPVAPHMMEEIWQVF
GHDESISYAKWPEYDPAKLVESTVEIMVQVNGKLRGKFKAAKDSAKDALEKEALSLDHVQ
KFLDGKDVKKVIVIPNKIVNIVAK
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaatcacaaaaccgtagaaaaaaagtggcaaaaatattgggcagagcatgatact
tttaagacaggaaatgatcctaagaagaaaaattattatgctttagatatgttcccattt
ccatctggcaagggacttcatgtaggacacccagaaggctatactgcaactgacattatc
tctagaatgaagcgagcacaaggttataatgtgcttcatccgatgggatgggatgctttt
ggcctgccaacagaacaatacgcattaaagactggtgaagatccagaaaaagttactaaa
gaaaatattgctaactttaaaaaacaacttaataagcttggcttttcatatgattgggat
cgcgaagtaacaacttctgaccctaattactacaagtggacccaatgggtttttgaacaa
atgtacaaaaaaggtttagcttatgaagctgaagttcctgttaactggtcaccagattta
ggaacagttgttgccaatgaagaaatcgttgatggtaaaactgaacgtggtggttaccca
gtttaccgtcgtaatatgcgtcagtggatgcttaagatgactgcttatgcagatcgctta
cttgaagatctagacgatttagattggccagaaccggttaaagaaatgcaacgtaactgg
attggtcgttcagaaggtgcacaagttacttttaaggttaaagatagtgataagactttt
gatgtctttactactcgtccagatactttatttggtgttagctacacagtgcttgctcct
gaaagtaaattagttcaagaaatcactactcctgagcaaaaagcggcagttgattcttac
attaagaaaattgaatctaagtctgaccttgaaagaactgatttgaataaggataagacc
ggtgtatttacaggtgcttacgcaattaatcctgttaatggcaaggaagttccagtttgg
atttctgattatgtcctagcaagttacggtactggtgcagtaatggcagtgccagctcat
gatgatcgtgattatgcttttgctactaaatttggtttaccaattaaccgagttattgaa
ggcggagatttagaaaaagaggctttcactggtaatggtaagcatattaattcggacttc
ttagacggcctagataatgaagaagctaagaagagaatgattgaatggcttgaagatcac
aatgctggtcaaaagaaggttaactataaacttcgtgactgggacttttctcgtcaacgc
tactggggtgaaccaattcctgttattcattgggaagatggcactacttcattagttcct
gaagatgaattaccacttcgtctgccacatgcaactgacattaagccatctggtactcca
gaaagcccacttgctaacttaactgactgggtaaatgttgttgataaaaatggtcgaaaa
ggtaagcgtgaaactaatacgatgcctaactgggctggttcttcttggtactacttacgg
tatattgatccgcacaatgataaagaattagcagattatgacttacttaaaaaatggctt
ccagtagacctttatattggtggtgcagaacacgcagttcgtcaccttctttacgctaga
ttctggcacaaggtactttatgacttaggtgttgtaccaaccaaggaaccattccaacgt
ttgtataaccaaggcttgattttgaagaatcacgaaaagatgtctaagtctaagggtaac
gtagttaatccagacgatgtgattgatgaatatggtgccgactcacttagaatgtatgaa
atgttcatgggcccacttgatgcttcaatcgactgggatgacaatggtccagcttcaact
aagaagttcctagatcgcgtatggcgtctatttgttaacgatctcgacttaaaagcaatt
ccgcaagaaagaattgttgacaaaaatgacggtgaacttgataaagtttatgctgaaacc
gttaagaaagttacagaagattttgatgccttacactttaatacagcaattagtcaaatg
atggtatttataaatgctgctcaaaaggctaagactattccacgtgaatatgctgaaggt
tttgttaagttgcttgctccagtggcaccacacatgatggaagaaatttggcaagtcttt
ggtcatgatgaatcaatctcttatgctaaatggccagaatatgatccagctaaattagtt
gaatcaactgttgaaattatggttcaagttaatggtaaacttcgtggaaaatttaaggct
gctaaagattctgctaaagatgctttagaaaaagaagctctttctcttgaccatgttcaa
aaattcttagatggaaaagatgttaagaaagtgattgttattccaaacaagatcgttaac
attgttgctaagtaa

DBGET integrated database retrieval system