KEGG   Lactobacillus gasseri: LGAS_0556Help
Entry
LGAS_0556         CDS       T00410                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lga  Lactobacillus gasseri
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LGAS_0556
Enzymes [BR:lga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LGAS_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
584678..585604
Genome map
AA seq 308 aa AA seqDB search
MMNKVTIVGSINVDNIMHIKKLPQPGETIAMSEFSKAAGGKGANQAVASSRAKNETIFVG
RVGDDDNGRFMLEQFKDNGVNVEHVTVTPNEQTGQAYILLQESGQNSIIIQHGANFDVTA
ADVRNAKSQIEDSDFVIAQFETPLEATIEAFKIARAAGKTTILNPAPARTDIPKELLELT
DLITPNETEAESITGIKVDSEESMKKSSELFHKMGIKGVIITIGERGSYVSYEDIEEIIP
AFKVKAVDTTAAGDTFLGALSSELKPDLSNLKESVVYASKSSSFTVQKLGAFPSIPTRDV
VEQALKEN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaataaagttacaattgttggatcaattaacgttgacaacattatgcatatcaaa
aagcttcctcaaccaggagaaacaatagcaatgtccgaattttcaaaggcagctggtggt
aaaggtgcaaaccaagcagtcgcaagtagtcgtgccaagaatgagacaatatttgttggc
cgtgttggggatgatgacaatggtcgctttatgcttgaacaatttaaggataatggcgtt
aatgttgaacatgtaacagtaactcctaatgagcaaactggtcaagcttatattttactt
caagaatctggtcaaaattcaattatcattcaacatggcgctaactttgatgtaacggct
gcagatgttagaaatgctaagagtcaaattgaagatagcgattttgtgattgcacaattt
gaaactccacttgaagcaactattgaagctttcaagattgctagagctgctggtaaaact
actattttaaatcctgctcctgctcgtactgacattcccaaagaattgttagagctaacc
gatttaattacacctaatgaaactgaagctgaaagcatcactggaattaaggttgatagc
gaagaatcaatgaagaagagcagcgaactcttccacaagatgggaattaagggtgtaatt
atcacaattggtgagcgtggttcttacgtttcttatgaagatatcgaagaaattattcca
gcttttaaggttaaggcagttgatacaaccgctgctggtgatactttcttaggtgcttta
tctagtgaattaaaacctgatttaagtaacttaaaagaaagcgtagtttatgcttctaaa
tcttcttcatttactgtacagaaattaggtgcatttccatccattccgactagagatgta
gttgagcaagctttaaaggagaattaa

DBGET integrated database retrieval system