KEGG   Lactobacillus gasseri: LGAS_0562Help
Entry
LGAS_0562         CDS       T00410                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lga  Lactobacillus gasseri
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LGAS_0562
Enzymes [BR:lga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LGAS_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
589566..592022
Genome map
AA seq 818 aa AA seqDB search
MINTVISNENYFKEILAMVINYDSEEYLKSVDAYWRAANYLSVGQLFLMNNPLLKGELKA
KDVKPKPIGHWGTIVPQNFIYAHLNRAIKKYDLNMFYIEGSGHGGQVMVSNSYLDGSYTE
RYPEITQDEKGMAKLFKQFSFPGGVASHAAPETPGSIHEGGELGYSLSHGVGAILDNPDV
IAAVEIGDGESETGPLATSWFSSKFINPIKDGAVIPILQINGFKISNPTIVSRMSDEDLT
KYFEGMGWKPYFVSAYKDGEFNGYKDHMEVHHEMAKTMDEVVEEIKAIQKHARENNDDSL
VKWPMIVFRVPKGWTGPKFDLDGNPIENSFRAHQIPIPVSQGDMSHKEMLTDWMESYKPE
ELFNEDGSPKEIVKENTLSGDQRMAMNPVTNGGINPKVLNMPDYRDFAVKFDKPGSVEKQ
DMAEWAKYLDKMAALNPTNFRGFGPDETKSNRLFQLLDNQKRQWMENIHTPNDENLAREG
RVIDSQLSEHQDEGWLEGYVLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKEQTWRHD
YPALNLVDTSTVFQQDHNGYTHQDPGMLTHLYEKNRPDLIHEYLPADTNSLLAVSDKAFR
DRECINVLVTSKQPRPQWFSIEEAKKLVDKGLGYIDWASTDKGAKPDVVFASTGTEPTIE
SLAAIDLLHKKFPDLKIRYINVIDVMKLMSPEKNPNAISNEEFDRLFPKGTPVIFAWHGF
KPMMESIWFDRGRGKNDVHIHGYEENGDITTPFDMRVLNHMDRYDLAKDVVESVSDLSEK
NADFIDEMDSLLAKHHQYIRDNGKDMPEVTEWQWNGLK
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgattaatactgtaataagcaatgaaaactatttcaaggagatacttgctatggtaata
aattatgattctgaagaatacttaaagagcgtcgacgcatattggcgtgctgccaactac
ttatcagttggtcagctatttttaatgaataatccactattaaaaggcgaattaaaggct
aaagatgtaaaacctaagccaattggacactggggcacaattgttccacaaaactttatt
tatgctcatttaaatcgagcaattaaaaagtatgatttaaacatgttctatattgaaggt
tctggtcatggtggccaagtaatggtatctaactcatacttagatggctcatatactgag
cgctatccagaaattactcaagatgaaaagggaatggctaagttgtttaagcaatttagt
tttccaggtggagttgcttctcatgctgcaccagaaacaccgggatcaatccatgaaggt
ggagagttaggttactcactttctcatggtgttggtgcaattttagataatcctgatgta
attgcagctgttgaaattggtgatggggaatccgaaactggcccacttgctacttcttgg
ttctcaagcaagtttattaatccaattaaagatggtgctgtaattcctatcttacaaatt
aatggttttaagatttctaacccaactatcgtttcaagaatgagcgatgaagatttaact
aaatattttgaaggaatgggctggaagccatactttgtttctgcatataaagatggcgaa
ttcaatggttacaaggatcacatggaagttcaccacgagatggctaagacaatggatgaa
gttgttgaagaaattaaggctattcaaaagcatgctcgtgaaaataatgatgattcatta
gtgaaatggccaatgattgtctttagagtacctaagggctggactggacctaaatttgac
ttagatggtaatccaattgaaaatagtttccgtgctcaccaaattccaattccagtttct
caaggggatatgagtcataaggaaatgcttactgactggatggaaagctacaagccagaa
gaattattcaatgaggatggatcacctaaggagatcgttaaagaaaataccttgtcaggc
gaccaaagaatggcgatgaatccagtaactaacggtggaattaatcctaaagttttaaat
atgcctgattaccgtgattttgcagtgaaatttgataaacctggttctgttgagaagcaa
gatatggctgaatgggcaaaatacttagataagatggctgccttaaatccaactaatttc
cgcggttttggtccagatgaaactaaatctaatcgtttattccaacttttagataatcaa
aaacgtcaatggatggaaaatattcatactccaaatgatgaaaacttggctcgcgaaggt
cgcgtgattgattcgcaattatctgaacaccaagatgaaggatggcttgaaggttacgtt
ttgacaggcagacatggcttttttgcaacttatgaagcatttggccgcgtagttgattca
atgcttacccaacacatgaagtggttaagaaaagcaaaagaacaaacttggcgtcatgat
tatccagctttgaacttagttgatacttcaactgttttccaacaagatcataacggttat
actcaccaagatcctggtatgttaacccacctttatgaaaagaaccgtccagatttaatt
catgaatacttaccagcagatactaactcacttcttgctgtatctgataaggcatttaga
gatcgtgaatgcattaacgttttagtaacttctaagcaacctcgtccgcaatggttctcg
attgaagaagctaaaaagttagttgataaaggtcttggctacattgattgggcatcaact
gataagggtgctaagccagatgttgtctttgcttccactggtactgaaccaacgattgag
tcattagctgcaattgacttattgcacaaaaagtttccagacttaaagattcgctacatt
aatgttattgatgtcatgaaattaatgtctccagaaaagaatccaaatgcaatcagcaat
gaagaattcgatcgtcttttccctaaaggtacaccagtcatctttgcttggcatggtttc
aaaccaatgatggagtcaatttggtttgaccgtggacgcggaaaaaatgacgttcatatt
catggctatgaagaaaatggtgatattactacgccatttgacatgcgagtattgaaccat
atggatcgttatgatttagcaaaagatgttgtcgaaagtgtttccgacctaagtgaaaag
aatgctgactttattgatgaaatggatagcttgcttgctaaacaccatcaatatattcgc
gataatggtaaagatatgcctgaagttacagaatggcaatggaatggtttaaaataa

DBGET integrated database retrieval system