KEGG   Lactobacillus gasseri: LGAS_0702Help
Entry
LGAS_0702         CDS       T00410                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lga  Lactobacillus gasseri
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LGAS_0702
   00052 Galactose metabolism
    LGAS_0702
   00500 Starch and sucrose metabolism
    LGAS_0702
   00520 Amino sugar and nucleotide sugar metabolism
    LGAS_0702
Enzymes [BR:lga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LGAS_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
685345..686253
Genome map
AA seq 302 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKAMPKEMVPIVDKPTIQFIVEEAKKSGIEDILIVTGKNK
RSIEDHFDANPELEQDLEEKGKTELLHLTQSITNLGVNLYYTRQPHPAGLGDAILRARSF
VGDEPFAVMLGDDLMDDKVPLTKQLIDRYDKTHASTIAVMPVPHEEVSKYGVIDPDNEIE
PGLINVKAFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFNGERHDVGNKEGYLETSIEYGLSHPQIKDDLRKYIIAMGQKLQNEDKKTNK
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagcagttattccagcagctggattaggtactagatttttacctgca
actaaggctatgcctaaggaaatggtaccaattgttgataaaccaacaattcaatttatc
gtagaagaagctaaaaaatcaggaattgaagatatcttgattgttactggtaagaacaag
cgctcaattgaagatcactttgacgctaacccagaactagaacaagatttggaagaaaag
ggtaagactgaacttttacacttgacccaatcaattactaatttaggtgttaacctttac
tacactcgtcaaccacatccagctggtttaggagatgcgattttaagagctcgcagcttc
gttggggatgaaccatttgctgttatgcttggtgacgacttaatggacgacaaggttcca
ctaactaagcaattaattgatcgctacgataagacacatgcatcaactattgctgttatg
cctgtaccacatgaagaagtttctaagtacggtgttatcgatccagataacgaaattgaa
ccaggcttgattaacgttaaagcctttgttgaaaagccagatgttgataaagctcctagt
gattacgcaatcattggtcgttacttattaactccagaaatttttgatattttagcacat
caaaaacctggtcgtggtggcgaaattcaattaactgacgctattgatactatgaacaag
actcaacgagtatttgctcatgtatttaacggtgaacgtcacgatgttggtaacaaggaa
ggttaccttgaaacctcaattgaatatggtttatctcacccacaaattaaagatgattta
cgtaagtacatcattgcaatggggcaaaaattacaaaatgaagataaaaagactaataag
aaaaaataa

DBGET integrated database retrieval system