KEGG   Lactobacillus gasseri: LGAS_0831Help
Entry
LGAS_0831         CDS       T00410                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lga  Lactobacillus gasseri
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lga00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lga00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
818059..818574
Genome map
AA seq 171 aa AA seqDB search
MRMIRFIWAEDEDGHIGYQGTLPWHLPADLKHFKDLTSNHIIVMGRRTFESFPGLLPKRQ
HIILSTSPTLQRKYQNNAHVKIFSQLKELKNWIKDHSEQTIDIIGGARVFEEFMDEVDMI
EKTKIHHVFKGDTLMPKINYEDFELINTKAHQADEKNKFAYDFLEYERKEK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgataaggtttatttgggctgaggatgaagatggacatattggttaccaaggg
acattaccttggcatttgcctgctgatttaaaacattttaaggatttaacttctaatcat
ataattgttatgggaagacggacctttgaaagtttccctggactgttgcctaaaagacaa
catattattctctcaactagtccaactttacaacgtaaatatcaaaataacgcacatgtt
aaaattttttctcaacttaaagaactaaagaattggataaaggaccatagtgaacagaca
attgatattattggtggagcaagagtttttgaagaattcatggatgaggttgatatgatt
gaaaagactaagattcaccatgtcttcaaaggtgatactttgatgccaaagataaattat
gaagattttgaactaatcaatactaaagctcaccaagcagatgagaagaataaatttgcc
tatgattttttagaatatgaaagaaaagagaaataa

DBGET integrated database retrieval system