KEGG   Lactobacillus gasseri: LGAS_0881Help
Entry
LGAS_0881         CDS       T00410                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lga  Lactobacillus gasseri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LGAS_0881
   01230 Biosynthesis of amino acids
    LGAS_0881
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGAS_0881
   00030 Pentose phosphate pathway
    LGAS_0881
   00051 Fructose and mannose metabolism
    LGAS_0881
   00052 Galactose metabolism
    LGAS_0881
  Energy metabolism
   00680 Methane metabolism
    LGAS_0881
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LGAS_0881
Enzymes [BR:lga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LGAS_0881
Protein phosphatases and associated proteins [BR:lga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LGAS_0881
Messenger RNA biogenesis [BR:lga03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LGAS_0881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
873553..874512
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTRTALANGIEVCGIRYGYAGLVAGDIFQMTSETVADK
INRGGTFLYSARFPEFKEEEVQLKGIEQLKKHGIDALVVIGGDGSYHGALKLTRHGYNAV
GLPGSIDNDIPYTDFTIGFDTACNTAMEAIDKIRDTATSHQRVFVVNVMGRDCGDIAMHV
GVATGADAIVIPEEPYDIKEIAENLKQGFANGKKHGIVVLAEGVMDANKFKDELLKYGDF
DARANILGHMQRGGSPTTRDRVLASEMGAYAVKLLLEGKGGLAVGIENNKLSHHDILDLF
DAKHHGNYALYSLNKDLAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggtggagatgcccctggtatgaacgctgccatt
agagctgttactcgtacagctttggcaaacggtatcgaagtttgcggaattcgttacgga
tatgctggtttagttgctggcgatattttccaaatgacttctgaaacagttgcggacaag
attaaccgcggcggtacctttctttactcagctcgtttcccagaatttaaggaagaagaa
gttcaacttaagggaatcgaacaattaaagaagcatggaatcgatgctttagttgtcatc
ggtggtgacggttcttaccatggtgcattgaaacttacaagacatggctataatgctgtt
ggtcttcctggttcaattgacaatgatattccttacactgatttcacaattggttttgac
actgcatgtaatactgcaatggaagccattgataaaattcgtgatactgcaacaagtcac
caacgtgtatttgttgtaaatgttatgggtcgtgattgtggagatattgcaatgcacgtt
ggtgttgctactggcgcagatgcaattgttatcccagaagagccttatgacattaaggaa
attgctgaaaacttgaagcaaggatttgctaatggcaagaagcatggaattgttgtttta
gcagaaggtgttatggacgctaataaatttaaggacgaacttcttaagtatggcgacttt
gatgctcgtgctaatatcttaggtcacatgcaacgtggcggaagcccaacaactcgtgat
cgtgtattagcaagtgaaatgggagcttatgctgttaagttgttacttgaaggtaagggc
ggcttagctgttggtattgagaacaacaagctttctcaccatgacattcttgatttgttt
gatgcaaaacaccacggtaattatgcgttatactcattaaacaaagacttagccaagtag

DBGET integrated database retrieval system