KEGG   Lactobacillus gasseri ATCC 33323: LGAS_1076Help
Entry
LGAS_1076         CDS       T00410                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LGAS_1076
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGAS_1076
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LGAS_1076
Enzymes [BR:lga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LGAS_1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1078973..1080460
Genome map
AA seq 495 aa AA seqDB search
MQYRSTRANLNYQLDAPAAIIQGLSPEGGLFVPTTFPKPIFDLEQFKNMSYQEMAKKVLA
TFFDDFSDEQLTQIVGESYGNQWDDKEVVKITKHANNYYLELFHGPTLAFKDIALQVLPR
LMHTAIKIKQNDSDIIILTATSGDTGGAAMSGFKGQDHTHVIVFYPYGGVSPVQLRQMLG
LKGGNLTAIAIKGNFDDAQTNVKKIFNNQALVKKLKLNKLQFSSANSMNIGRLIPQIVYY
FYSYVQLVKNGQISAGQEINFSVPTGNFGDILAGYYARKLGLPIHKLICASDQNNVLTDF
FETGTYDRQRKFYLTNSPAMDILVSSNLERLLFDLYDENADELSKLMNKLSKEGKYTISP
AVKEKLAQLFAAGFATEDEVETEIKRIYEKDHYTLDPHTAVASFVTKKYQEISLDQTPTV
IVSTASPYKFPETVFHALTGKEVKEKGVPAIKELNSFLKEDLSGNVNNLIQTGNYQEQII
DASEMENALLNILDI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcgtagtacacgcgctaacttaaattatcaattagatgctcccgcagctatt
attcaaggattatcaccagaaggtggtctttttgttccaactacttttcctaagccaatt
tttgatttagaacaatttaaaaatatgtcctaccaagaaatggctaaaaaagttttagca
accttctttgatgatttctcagatgaacaacttactcaaattgtaggcgaatcttatggt
aatcaatgggatgataaagaagttgtcaaaattactaaacatgcaaacaattattatcta
gaactcttccatggtccaacgcttgcctttaaagatatcgccttacaagtacttcctcgt
ttaatgcatacagctatcaaaatcaaacaaaatgattctgatatcattattctaactgct
acttcaggagacactggcggtgcagcaatgagtggttttaaaggtcaagaccatactcac
gttattgtcttctacccttacggcggtgtaagtcccgtacaattaagacaaatgctaggt
cttaaaggcggtaacttaactgcgattgccattaaaggtaactttgatgatgctcaaact
aacgtgaagaaaatttttaataatcaagctttagttaaaaaattaaaactaaacaaattg
caattttcttccgctaattcaatgaatattggccgcttaatcccgcaaattgtctattat
ttttatagttatgttcaactagttaaaaatggtcaaatttcagctggacaagaaattaat
ttttccgttccaactgggaactttggcgatattcttgcgggctactatgctagaaaatta
gggctaccaattcataaacttatttgtgcttctgatcaaaataatgttttgactgatttc
tttgaaactggtacttatgatcgtcaacgtaagttttacttaactaactcccctgccatg
gatatcttagtttcaagtaatttagagcgattattgtttgacctttatgatgaaaacgct
gatgaactatcaaaattaatgaataaattaagcaaggaaggaaaatatacaatcagtcca
gctgttaaggaaaaattagctcagttatttgcagctggttttgctacagaggatgaagtt
gaaactgaaattaaacgtatctatgaaaaagatcattacacactcgatccacatacagca
gttgcctcttttgtaactaaaaagtatcaagaaattagtcttgatcaaacaccaactgtg
atcgtttcaactgctagcccatataagttccctgaaacagtctttcatgcacttactggt
aaagaagtaaaagaaaaaggcgttcctgctattaaagaattgaatagcttcttaaaagaa
gacttaagcgggaatgtaaacaatttgattcaaactggtaattatcaagagcaaataatt
gatgctagcgaaatggaaaatgctttacttaatattttagatatctaa

DBGET integrated database retrieval system