KEGG   Lactobacillus gasseri: LGAS_1093Help
Entry
LGAS_1093         CDS       T00410                                 

Definition
orotidine 5'-phosphate decarboxylase
Orthology
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
lga  Lactobacillus gasseri
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LGAS_1093
Enzymes [BR:lga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     LGAS_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1102176..1102883
Genome map
AA seq 235 aa AA seqDB search
MTRPVIVALDLDNEKKLNELLPKLGKPENVFIKIGMELFFNEGPAIVRNLSRQGYQIFLD
LKMSDIPNTVYNGAKALAQLGITYTTVHALGGSQMIKAAKEGLIAGTPVGKNIPKLLAVT
ELTSISDDILHEEQNCNLSMNQQVLSLAETAKKAGADGVICSPLEVKNLRQNVGDDFLYV
TPGIRPAGNAKDDQSRVATPAQAKEWGSTAIVVGRPITLATNPEAAYEAIKKEFN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaccagttatcgttgccttagatttagacaatgaaaagaaattaaatgaactc
ttacctaagctaggtaaaccagaaaatgtttttattaaaattggaatggaactctttttt
aatgaaggtcctgcaattgttagaaacttatctagacaaggctaccaaatttttttagat
ttaaagatgagtgatatacctaataccgtctacaatggtgctaaagccttagctcaatta
ggaatcacttatactactgtccatgctcttggtggtagtcaaatgattaaagcagcaaaa
gaaggtttaattgctggcaccccggtcggtaaaaatatccctaaattattagctgttaca
gaattaacttcaatttctgatgatattttgcacgaagaacaaaattgtaacttatcaatg
aaccagcaagttttaagtctagctgaaactgccaaaaaggctggagctgatggagtaatt
tgttcaccattagaagttaagaatttgcgtcaaaatgttggcgatgactttttatacgta
actcctggcattcgcccagcaggaaatgccaaagatgatcaatctagagtagctacccca
gcccaagcaaaagaatggggttcaaccgctatcgtcgtaggacgaccgattaccctagca
actaatccagaagcagcatacgaagcaattaagaaggagttcaactaa

DBGET integrated database retrieval system