KEGG   Lactobacillus gasseri ATCC 33323: LGAS_1306Help
Entry
LGAS_1306         CDS       T00410                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga00010  Glycolysis / Gluconeogenesis
lga00051  Fructose and mannose metabolism
lga01100  Metabolic pathways
lga01110  Biosynthesis of secondary metabolites
lga01120  Microbial metabolism in diverse environments
lga01130  Biosynthesis of antibiotics
lga01200  Carbon metabolism
lga01230  Biosynthesis of amino acids
Module
lga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lga_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGAS_1306
   00051 Fructose and mannose metabolism
    LGAS_1306
   00562 Inositol phosphate metabolism
    LGAS_1306
Enzymes [BR:lga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LGAS_1306
Exosome [BR:lga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LGAS_1306
  Exosomal proteins of bladder cancer cells
   LGAS_1306
  Exosomal proteins of melanoma cells
   LGAS_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DrsE
Motif
Other DBs
NCBI-ProteinID: ABJ60669
JGI: LGAS1306
UniProt: Q042F3
Position
complement(1297570..1298325)
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKLHMNPEQTVEFVNAVKGKLPDPSKVESVIAAPAVDLYVLKKAAEGSDLH
TGAENAYFEVEGAFTGETSPKVLNEMGIDYCIIGHSERRGYFHETDEDINKKAKALFANG
VTPIICCGESLETREANKQEDWVVAQIKAALDGLTAEQVSKLVIAYEPIWAIGTGKTASA
DQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLDP
ESFLALVNYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccaattattgctggtaactggaaattacatatgaacccagaacaaactgtt
gaatttgtaaatgcagttaagggcaagttaccagatccaagtaaagttgaatcagttatt
gctgcacctgcagttgatctttacgttttaaagaaggctgccgaaggctcagatttacat
actggtgcagaaaatgcatactttgaagttgaaggtgcatttactggtgaaacttcacct
aaagttttaaacgaaatgggtattgactactgtattattggtcactcagaacgtcgtggc
tacttccacgaaactgatgaagacattaacaaaaaggctaaagctttatttgctaatggc
gtaactccaattatttgctgtggtgaatctcttgaaactcgtgaagctaataagcaagaa
gattgggtagttgctcaaatcaaagctgctttagatggtttaactgcagaacaagtttct
aagcttgttattgcttatgaaccaatttgggctattggtactggtaagactgcttctgct
gatcaagcggaagaaatgtgcaagactattcgtgaaactgtaaaagacttgtacaacgaa
gaaactgctgaaaacgttcgtattcaatacggtggttcagtaaaaccagctaacgttaaa
gaattaatgtctaagcctgacattgatggtggcttagttggtggtgcttcacttgatcca
gaatcattcttagcattagtaaactaccaagattaa

DBGET integrated database retrieval system