KEGG   Lactobacillus gasseri ATCC 33323: LGAS_1374Help
Entry
LGAS_1374         CDS       T00410                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
lga00071  Fatty acid degradation
lga00072  Synthesis and degradation of ketone bodies
lga00280  Valine, leucine and isoleucine degradation
lga00310  Lysine degradation
lga00362  Benzoate degradation
lga00620  Pyruvate metabolism
lga00630  Glyoxylate and dicarboxylate metabolism
lga00640  Propanoate metabolism
lga00650  Butanoate metabolism
lga00900  Terpenoid backbone biosynthesis
lga01100  Metabolic pathways
lga01110  Biosynthesis of secondary metabolites
lga01120  Microbial metabolism in diverse environments
lga01130  Biosynthesis of antibiotics
lga01200  Carbon metabolism
lga01212  Fatty acid metabolism
lga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LGAS_1374
   00630 Glyoxylate and dicarboxylate metabolism
    LGAS_1374
   00640 Propanoate metabolism
    LGAS_1374
   00650 Butanoate metabolism
    LGAS_1374
  Lipid metabolism
   00071 Fatty acid degradation
    LGAS_1374
   00072 Synthesis and degradation of ketone bodies
    LGAS_1374
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LGAS_1374
   00310 Lysine degradation
    LGAS_1374
   00380 Tryptophan metabolism
    LGAS_1374
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LGAS_1374
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LGAS_1374
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LGAS_1374
Enzymes [BR:lga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LGAS_1374
Exosome [BR:lga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LGAS_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF543
Motif
Other DBs
NCBI-ProteinID: ABJ60736
JGI: LGAS1374
Position
complement(1370948..1372114)
Genome map
AA seq 388 aa AA seqDB search
MLQDVYIVGMNRIPFGKYRGFYKDENAVDLGVLALKGLLKKNIVAQDKIDNILIGNVLSA
GLGQNVARQIALKSGLPESVVATSVDDVCGSSLKALRLAQGQMLLGDSEIAVVGGAESMT
NAPLLLNKSNKHDENPVYRDSLMIDGIGDAYSEKPMGITAENVADKYQVTRQDMDEFARD
SHAKAYAAQENNWFEEEYTPVKLNEKVLDHDETIRPDTSLDALGQLKPVFKENGRVTAGN
SSPLTDGASMVLLANQQKLDDLDLTPLAYLGAYAEIGCDPAYMGYAPYFAIEKLLKETNS
TIDDYDLVEINEAFAAQAYAVARDLDIPKEKLNIAGGAISLGHPLGATGTRLVISAVNSL
RKINGRRAIVSLCIGGGQGIAYETRRII
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgttacaagatgtttatattgtgggaatgaatcgaattccttttggcaaatatcgcgga
ttttataaggatgaaaatgctgtcgatttgggtgtcttagcactgaaaggcttattgaaa
aagaatattgtagcgcaagataaaatcgataatatcttaattggaaatgttttaagtgct
ggtttaggccaaaatgttgcacgtcaaattgctttaaaatcaggattacctgaatctgtt
gttgctacaagtgttgatgatgtttgtgggtctagtttaaaagctttacggttggcacaa
gggcaaatgttacttggtgattctgaaattgctgtcgttggtggagctgaaagtatgaca
aatgctcctcttttacttaataagagtaataagcatgatgaaaatccagtatatcgagat
agtttaatgatagatggaattggggatgcctattctgaaaaaccaatgggaattactgct
gaaaacgttgctgataaataccaagttactcgtcaagatatggacgaatttgctcgtgat
tctcatgctaaggcttatgctgctcaagagaataattggtttgaagaggagtatacccct
gttaagttaaacgagaaagttcttgaccatgatgagacaattcgaccagatactagttta
gatgctttgggacaactcaaacctgtatttaaagaaaatggccgtgttacagccggaaac
tcatccccattaactgacggagcaagcatggtacttcttgccaaccaacaaaagttagat
gatttggacttaacgccattagcttatttaggtgcttatgcggaaattggctgtgatcct
gcttatatggggtatgcaccatattttgcaattgaaaaattgctaaaagaaaccaacagt
acaattgatgattatgatttagtcgaaattaatgaagcatttgcggcgcaagcttatgca
gtagctcgtgatttggacattccaaaagaaaaactaaatattgctggcggggcaatcagt
ttaggccatccgttaggtgcgacaggtacgcgtttagtaataagtgcagtaaatagtttg
cgtaagatcaatggtcgaagagcaattgtttctttatgtattggtggcggtcaaggaatt
gcatatgaaaccagaagaattatctaa

DBGET integrated database retrieval system