KEGG   Lactobacillus gasseri ATCC 33323: LGAS_1761Help
Entry
LGAS_1761         CDS       T00410                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lga  Lactobacillus gasseri ATCC 33323
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LGAS_1761
   01230 Biosynthesis of amino acids
    LGAS_1761
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGAS_1761
  Energy metabolism
   00680 Methane metabolism
    LGAS_1761
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGAS_1761
Enzymes [BR:lga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LGAS_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(1746522..1747148)
Genome map
AA seq 208 aa AA seqDB search
MDLLLVRHGISEHNTSDVISGGTSNPNLSQAGVKQVEEISKIIDNNKIDQVYASPLIRAK
RTAQILTDFQKDIITDDRLKEMDFGSWEGQHAEGLKVKYPDAFDDLGTINSKYTKYAKDG
ETFEQVADRVEDFLAEIQPNSNDKTIMVVCHGFVIRSLIARWFKLKIEDVMTVRNVSFTE
LHFEKDDVERPRLMTFNRTEPLYYGTKR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatttgttattagtaagacatggaattagtgagcacaatacttcagatgtaatctcc
ggcggtactagtaaccctaacttaagccaagctggtgttaagcaagtagaagaaataagt
aaaataattgataataataaaattgatcaagtctatgctagtcccttaattcgtgctaaa
agaacggcgcaaattttaactgattttcaaaaagatattattactgatgaccgtcttaaa
gaaatggattttggttcatgggaaggtcaacatgcggaaggattgaaggtgaaatatccc
gacgcattcgatgatttagggactattaatagcaaatatacaaaatatgctaaagatggc
gaaacttttgagcaagtggctgatcgagttgaagattttttagctgaaattcaaccaaat
tctaatgacaaaacgattatggttgtctgtcacggatttgtaattaggagtttaatagct
agatggtttaaactaaaaattgaagatgtaatgacggtcagaaatgttagttttactgaa
cttcattttgaaaaagatgatgttgagcgaccacggttgatgacatttaatcggacggag
cctttatattacggaactaagaggtaa

DBGET integrated database retrieval system