KEGG   Lactobacillus gasseri: LGAS_1768Help
Entry
LGAS_1768         CDS       T00410                                 

Definition
glycerophosphoryl diester phosphodiesterase
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
lga  Lactobacillus gasseri
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:lga00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1751676..1753466)
Genome map
AA seq 596 aa AA seqDB search
MEDRFLKNIFQEINRYANNFRKYWLQYIALFIGIDLFTQVLIIPLFRYLTTAILKASAIP
FISYQNIITIISTHTLMFLCLILELIVLLLVIYGEFSLILLGIREISQGRFSFRVLFREL
WQSYRSVRIGSVLLLAVYFLLIVPFADLVYRTPLLAKVQIPEFILDFMTRNIWLASGLII
FYLLAFILGIRLILTLPIMIYQRKKTFLAMKESWNLTSRKYWWKLLSRLLVLGFSASIIL
LIFNLLIYLCQLGLDRLPRNVSFIFAVFNLLLVQLVSELVAIWISIISLLIVVAPLKSFK
LQSKVKKTIKLKVLALCLMLVFALAAGANNVLYLKEIDMQRPLTISHRGVSDKNGVQNTI
PALKKTAKLHPDYVEIDLHETKDKQFVVMHDENLKQLAGINKTPKDLTLKQLTRITLRED
GHRAKIASFDQYLKAAAKIKQKLLIEVKTTPNDSTKMLQNFNKKYGKLIIKRKYQVQSLD
YRVIEGLHQINPKLFVLYIQPYNFTYPQSVANGYSMEYSTLNNDFIWQAQLQNKPVYAWT
VNAPNMMMKMMYDNVNGIITDQLAELNETIKDFEDNQSYANKLLNFILILPNESAS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggaggataggtttttgaagaatatttttcaagaaataaataggtacgctaataatttc
agaaaatattggcttcaatatatagccttatttattggaattgatctttttacgcaggta
cttattattccgctttttaggtatctaactacagctattttaaaagctagcgcaattcca
tttatttcatatcaaaatattattacaatcatcagcacacacactttgatgtttctctgt
ttaattctggaattgattgttttacttctagtaatttatggtgaattctcactgatattg
ttaggaattagagaaatttctcagggaagattttcatttagggtcctatttagagaatta
tggcaatcatatcgatcagttcgaattggctcagttttgctactagcagtgtatttttta
ctaattgttccatttgctgacctagtttatcgaacaccattattagctaaggttcaaatt
ccagagtttattttagattttatgacacggaatatttggcttgctagtggattaataatc
ttttatttgttggcttttattttaggaatacgtcttattttgacgcttccgattatgatc
tatcaaagaaaaaagacttttcttgccatgaaggaaagctggaatttaactagtcgtaag
tattggtggaagctcttaagtcgcttgctagtattagggtttagtgcaagtataatttta
ttaatttttaacttgttaatttatctttgtcaattaggtttagatcgtttgccgagaaat
gtcagttttatcttcgctgtatttaatcttttactggtccaattagtcagtgagttagtt
gcaatttggattagcattatttcacttttaattgtggttgctccattaaagagttttaag
cttcaaagtaaagtgaaaaaaacaataaaactaaaagtattagctttatgtttaatgcta
gtttttgcacttgctgctggtgcaaacaatgttttatatctaaaagaaatcgatatgcag
cgtccacttactatctcacaccgcggagtaagtgataaaaatggcgtacaaaatactatt
ccagctttgaaaaaaacagccaagcttcatccagattatgtagaaattgacttacatgaa
acaaaagataagcaattcgtagtgatgcatgatgaaaacttaaagcaattagctggaatt
aataagacgccaaaagatttaactttaaaacagctaactagaattacgcttcgtgaagat
ggacatcgggctaaaattgctagttttgaccagtatttaaaagcggctgctaaaataaag
caaaaattgctgattgaagttaagacaacgccaaatgattcgactaagatgttgcagaat
tttaataaaaaatatggaaaattaattattaaacgaaaatatcaagttcaatcgttagac
tacagagtgattgaaggcttgcatcagattaatcctaaattatttgttttatatattcag
ccgtataattttacctatcctcaaagcgtagctaatgggtactctatggaatactcaact
ttaaataatgactttatttggcaagcacaattacagaataagcctgtttatgcctggacg
gttaatgctccaaatatgatgatgaaaatgatgtatgacaatgttaatggaattattacc
gatcaacttgctgaattaaatgaaactattaaagattttgaagataatcagagttatgcg
aataagttattaaactttattttgatattgcctaacgaaagcgcttcatga

DBGET integrated database retrieval system