KEGG   Leuconostoc gelidum: C269_00115Help
Entry
C269_00115        CDS       T02322                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lge  Leuconostoc gelidum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C269_00115
Enzymes [BR:lge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     C269_00115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23824..24762
Genome map
AA seq 312 aa AA seqDB search
MKNKVVIIGSLNIDTIQMVDRLPKQGETISISNQASNFGGKGANQAVAAARQGADVTFIG
AVGNDDRGRAFKQLLTDEGITTDYIFTKKQPTGSATIMLEADGHNTIMVFGGANMSLNAS
DIVQAHDVIAAADVVVAQLEVPIDAVAKGFEIARAFGALTILNPAPITSHLSAEIMINTD
LVIPNETEAAALAHVTPTTNIEALGELTGQLKKLGMVNTIVTLGGDGVYYNVKGKTGQLP
IFKVKAVDTTAAGDTFIGTIAANISQSMNDLPAIITRSSFASSLTVSRSGAIVSIPTKAE
VDAGLQNSSIVK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaagttgtgattattggcagcctcaatatagatactattcaaatggttgat
cgcttgcctaaacaaggggaaacgattagcattagcaaccaagcaagtaattttggtggt
aaaggtgcaaatcaagctgttgctgctgcccgtcaaggtgcggatgtgactttcattggt
gcggttggcaatgatgatcgtggtcgtgcatttaagcaattattaacagatgaaggtatt
accacagattacatttttactaaaaaacagccgactggatcggctacgattatgctagag
gccgacggtcataatacgatcatggtttttggtggcgccaatatgagtttaaatgcatca
gatattgtgcaggctcatgatgtgattgctgcagccgatgttgttgttgcccagctagag
gtaccaattgatgcggtggctaaaggatttgagattgctcgtgcatttggcgcacttaca
attctcaatccagcacctatcacttcacatttgagtgctgaaatcatgattaacacagat
ttagtgattccaaatgagactgaggcggctgccttagcgcatgttacaccaacgactaat
atagaagcattaggtgagttgaccggccaattaaaaaaattgggtatggtgaatacaatt
gtgactctcggtggcgatggtgtttattacaatgtcaaaggcaagactggacagttacct
attttcaaagttaaagcggttgatacgactgcagctggtgatacgtttattggtacaatc
gctgcaaatatttctcagagtatgaacgatttaccagcaattattactcgaagtagcttt
gctagttctttaacggttagtcgttcgggtgcaattgtgtcaattccaacaaaagcagaa
gttgatgctggcctacaaaattccagtatagtgaaatga

DBGET integrated database retrieval system