KEGG   Leuconostoc gelidum: C269_00670Help
Entry
C269_00670        CDS       T02322                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lge  Leuconostoc gelidum
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C269_00670
Enzymes [BR:lge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     C269_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126614..128068
Genome map
AA seq 484 aa AA seqDB search
MYKETYPKTFPKGFLWGGATAANQVEGAWNIDGKGMSTAEVVQKADDRRQMSMSDVTQET
LQVALADTTVERYPKRRGIDFYHHYKEDIALFAEMGFKVYRFSIAWSRIFPKGEDQVPNE
AGLVFYDHVLAELEKYDIKPLVTLSHYEMPIALTQKYNGWAGRETIAAFNRFTETVFNRY
KKQVPYWLTFNEINTGTWGFHETGAIDKGLSEKEQLQIRYQALHHQFVASAIATKQLREI
DSTAKIGSMLARMQTYPATPNPKDVRAAQLADEKNLFFTDVQARGEYPEYMNRFFHENDI
VIQMAEDDQAILLANLVDFISFSYYMTNVTAHNQVGDGAGNMAVGGRNPYLKESDWGWQI
DPVGLRISLNTMWDRYRKPLFIVENGLGALDKLENGQVHDQYRIDYLRQHIEQMKESIKD
GVDLLGYTMWGPIDLISFSTSEMSKRYGFIYVDQDDNGEGTLKRIKKDSFEWYQQVIKTN
GEQL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagaaacatatccaaagacgtttcctaaaggatttttgtggggcggtgctacg
gcagcgaaccaagttgaaggggcttggaacattgacggtaaaggaatgagtacagctgag
gttgtacaaaaagctgatgatcggcgacaaatgtctatgagtgatgtcacacaagaaact
ttacaagttgctttggctgacacgacagttgagcgttatcctaaacgccgaggcattgat
ttttatcaccattacaaagaagacattgcactttttgctgaaatgggatttaaagtttat
cgattttcgattgcctggtcaagaatttttccaaagggtgaagatcaagtgcctaacgaa
gcaggattagtattttatgatcatgttttggcagaattagaaaaatatgatatcaaacca
ctagtgactctttctcattatgaaatgccaattgcattgacgcaaaaatataatggttgg
gccggtcgtgaaacaattgccgcattcaatcgtttcacggaaacggtgtttaatcgttac
aaaaagcaagtaccatattggctaacctttaatgaaattaacactggtacttggggattt
catgaaacgggtgccattgataaaggactttctgaaaaagaacagttacaaattcgttat
caagcgctgcatcatcagtttgtagccagtgcaattgcgaccaaacaattacgtgaaatt
gattcaacagctaagataggatcgatgttagcacgtatgcaaacgtatccagcgacaccc
aacccgaaagatgttcgtgcggcacaattggcagatgaaaagaatttattctttactgat
gtacaagcacgtggtgagtatcctgaatatatgaaccgattctttcatgaaaatgacatt
gttattcaaatggcagaagatgatcaagctattttacttgcaaatttagttgattttatt
agtttcagttactatatgaccaatgtgactgcgcacaatcaagttggagatggtgccgga
aacatggctgttggcgggcgtaatccatatttaaaagaatcggattggggatggcaaatt
gatcctgttggtttacgtattagtttgaatacgatgtgggatcgttatcgtaagccacta
tttattgtcgaaaatggcttgggtgctcttgacaagctagaaaatggtcaagtacacgat
caatatcgtattgattatttacgtcagcatattgaacaaatgaaggaatcaattaaagat
ggtgttgatcttttaggatatacaatgtggggaccaattgatttgattagtttctcaaca
tcagaaatgtctaagcgttatgggtttatctatgttgatcaagatgataatggtgagggc
acactcaaaaggattaaaaaagattcatttgagtggtatcagcaagtcattaaaacaaat
ggtgagcaattataa

DBGET integrated database retrieval system