KEGG   Leuconostoc gelidum: C269_00950Help
Entry
C269_00950        CDS       T02322                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lge  Leuconostoc gelidum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    C269_00950
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C269_00950
   00620 Pyruvate metabolism
    C269_00950
   00650 Butanoate metabolism
    C269_00950
  Lipid metabolism
   00071 Fatty acid degradation
    C269_00950
  Amino acid metabolism
   00350 Tyrosine metabolism
    C269_00950
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C269_00950
   00626 Naphthalene degradation
    C269_00950
Enzymes [BR:lge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     C269_00950
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     C269_00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188191..190893
Genome map
AA seq 900 aa AA seqDB search
MADTIVKKPVKKVLTPEEKAELQIQAEAMTAALVEKSKIALATFSTYTQEQVDKIVAAMA
LAGSENSLVLAHAAYDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVISEDKIQGKVE
LAAPLGVLAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQAQKSSALAAKIVYDAAVK
AGAPENFIQWIEKPSLYGTSALIQNQGIASILATGGPAMVNAALKSGNPSMGVGAGNGAI
YLDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPIYDEVLQKMQAQGAYLVPKKDY
KKIADYVFKPNAEGFGIAGPVAGMSGRWIAEQAGVKIPEGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVEKREEAIKTVQSLLNYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWIRL
PKEVYYEANAITYLQELPSIKRAFIVADPGMVQFGFVGKVLSQLELRQEQVETNIYGSVK
PDPTLSQAVDIARQMAAFKPDTVILLGGGSALDAGKIARFLYEYSTRHDGILEDEDGIKE
LFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDQTHVKYPLADY
ELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHAFESYVSVMASEFTRPWALQAIRLIFDN
LTTSYQYDPKNPTKEGQNARTKMHYASTLAGMSFANAFLGINHSLAHKTGGEFGLPHGLA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARYLGLKGNTDAEMVDALIAAV
KTLAKSVEVDQTLTGNGVKKADLENNIDQLTDLVYNDQCTPGNPRQPSLEEIKQLLRDQL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacaattgtaaaaaagcctgtaaaaaaggttttgacacctgaagaaaaagca
gaactacaaatacaagctgaagcaatgacagcagcattagttgaaaaatcaaaaatagca
ttagcaacgttttcaacctatacacaggaacaagttgataagatcgtagcagcgatggca
ttagcaggttcagaaaattctttagtattagcccatgcagcgtacgatgaaactggtcga
ggtgttgttgaagataaagatacaaaaaatcgttttgcatcagaatctgtttataacgca
atcaaatttgataagacagttggtgtaattagcgaagataagattcaagggaaagttgaa
ttggctgcaccgttaggcgtcttggctggtatcgtgcccacaactaatccaacatcgaca
acgattttcaagtcaatgctaacagcgaagacacgaaacacaattatctttgcatttcat
ccacaagcacaaaaatcatcggcacttgctgcaaaaattgtttatgatgcagctgttaag
gctggtgcacctgaaaactttattcaatggattgaaaagccatcactttatggtactagt
gcgttaattcaaaatcagggcattgcatctattctagctactggtggtcctgcaatggtt
aatgcagccttgaagtcgggaaatccttcaatgggtgttggtgctggaaacggtgctatt
tatcttgatgcaacagttgatactgaccgtgcggtatctgacttgttgttgtcaaaacgt
tttgataatggtatgatctgtgctactgaaaattcagcagtcattcaagccccaatttat
gatgaagtacttcaaaagatgcaggctcaaggtgcttatttagtacctaaaaaagactac
aaaaaaattgctgattatgtgtttaagccaaatgccgaaggctttggaattgctggccca
gttgctggtatgtcaggccgttggattgctgaacaagctggcgtgaaaattcctgaaggc
aaagatgtcttactgtttgaattggatcaaaaaaacattggtgaagctttgtcttcagaa
aagttgtcaccgttactttcaatttataaggttgaaaagcgtgaagaggctattaaaaca
gtacaatcattgctgaactatcaaggtgccggacacaatgctgctattcaaattggttca
caagatgatccatttattaaagaatatgcggatgcaattggtgcatcacgtatcttggtt
aaccaaccggattcaatcggtggtgttggcgatatctatacagatgctatgcggccatca
ttgacgcttggtaccggatcatgggggaagaattcattgtctcacaacttatcaacatat
gacttgcttaacattaaaacagtggctcgcagacgtaaccgaccacagtggattcgttta
cctaaagaagtctactatgaagcaaatgcaatcacttacctgcaagaattgccatcaatt
aagcgggcattcattgttgctgatcctggtatggtgcagttcggatttgttggtaaagta
ttgagccaacttgaattacgtcaagaacaggtagaaacaaacatttatggttcagttaaa
cctgatccaactttatcacaagctgttgatattgcccgtcaaatggctgcatttaagcca
gacactgttattctacttggtggtggttcagcgcttgatgctggaaaaattgcgcgtttc
ttatacgaatattcaacacgtcacgacggtattttagaagacgaagacggtatcaaagag
ttattcatggaattacaacaaaagttcatggatattcgtaagcgtatcgttaagttctat
catgcgcgtttgacgcaaatggttgctattccaacaacatctggtactggttcagaagtg
acgccattcgcggtaataactgatgatcaaacacatgttaagtatccattggctgattat
gaattgacacccgaggtagcgattgtcgatccagagtttgttatgaccgtgccaaagcgc
acagtagcattctcaggtttggatgctttgtcacatgcatttgaatcttatgtgtcagtt
atggcatcagaatttacacgcccttgggctttacaagctatcaggttgatttttgacaat
ttgacaacatcatatcaatacgatccaaaaaatccgacaaaagaaggtcaaaacgcgcgc
acaaagatgcactatgcctcaaccttagctggtatgtcgtttgccaatgcgttcttagga
attaaccattcgctagcccacaaaactggtggtgaattcggtttgcctcatggcttggca
attgcaattgcaatgcctcatgtcatcaaatttaatgcggtgactggtaacgttaagcgt
acgccttatccacgctatgaaacttacacagcgcaaaaagattatgcagatattgcccgt
tatcttggattaaagggtaatacagatgctgagatggttgatgctttgattgctgctgta
aaaacgttagctaagtcggttgaagttgaccaaactttgactggtaatggcgttaagaaa
gcggatttagaaaataatattgatcagttgacagaccttgtctacaatgatcagtgcaca
ccaggcaatccacgccagcctagtttagaagaaatcaaacaattgttgagagatcaactt
taa

DBGET integrated database retrieval system