KEGG   Leuconostoc gelidum: C269_01335Help
Entry
C269_01335        CDS       T02322                                 

Gene name
gltX
Definition
glutamyl-tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lge  Leuconostoc gelidum
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lge00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281867..283363
Genome map
AA seq 498 aa AA seqDB search
MTEEIRVRYAPSPTGHLHIGNARTAIFNWLFARHYNGKFIIRIEDTDTARNIADGEKSQL
DNLAWLGLDWDESPANPGEYGPYRQSERNEQGLYQPFIDELLAKGRAYKSYKTTETIAAE
REAQQAAKQAPHYVYEYEGLTSEEREAKYAEFEAQGLKAVVRFRVPEEKVYAWNDIVKGH
IEIGAKEVGGDWVIQKTDGMPTYNFAVVVDDHLMKISHVLRGDDHVSNTPKQIMIFEALG
WDVPKFGHMALIINGETGKKLSKRDENLLQFVEQYHELGYQPQAMVNFIGLLGWSPKGED
EIFSLESFKQMFDETRLSKANAKFDQKKLEWINNQWMRRDLDQVMPQLIQELVNANLVSA
ADAETKKDWLAEVIKVAGVEGISYTREVVALVRQPFFELGDMTDEMVDYLTSDDGRKVFS
AWESAYTALPESATAEDYMNTIRSIQNTLDIKGRNLWNPIRIATTHEIQGPNLPEMLVVM
DKKTILSTMADIKATYLN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaaattcgtgttcgctacgcaccatcaccaacgggccacttacatattggt
aatgcgcgtacagcaatctttaactggctttttgcgcgccattataatggcaagttcatt
atccgtattgaagatactgatacagcgcgtaatattgcggacggtgagaaatcacaatta
gataatttggcttggcttgggttggattgggatgaatcaccagcaaatcctggtgagtac
ggaccttaccgtcaatcagaacgtaatgaacaagggttataccaaccatttattgacgaa
ttattggctaagggacgggcttataagtcatataaaacaacggaaacaattgcagctgag
cgtgaagcacaacaagcagcgaagcaagcaccgcattatgtttacgagtatgaagggcta
acatctgaagaacgtgaagccaaatatgctgaatttgaagcgcagggattgaaagctgtc
gttcgtttccgtgttcctgaagaaaaagtttacgcatggaatgatattgttaaaggtcat
attgaaattggcgccaaagaagttggtggtgactgggttattcaaaaaactgatggcatg
ccaacttacaattttgcagtggttgtggatgatcatttgatgaagatctctcacgtatta
cgtggcgatgatcatgtatcaaacacaccaaaacaaattatgatctttgaagccttaggt
tgggatgtaccaaagtttggtcatatggcattgattattaacggtgaaacaggcaaaaag
ttatcaaagcgtgatgagaatctgttgcaattcgtagaacaatatcacgaattgggttat
caaccacaagcaatggtcaattttattggtttacttggttggtcgccaaagggtgaagac
gagattttctcacttgaatcatttaaacaaatgtttgacgaaacgcgtttgtcaaaggct
aatgctaaatttgaccaaaagaagttggaatggattaacaaccagtggatgcgtcgtgat
ttagatcaagtgatgccacaattaattcaagaattagtaaacgctaatttagtttccgcg
gctgacgcagaaactaaaaaagattggcttgctgaagtgatcaaggtagctggcgtggaa
ggcatttcttacacacgcgaagttgttgcgttagtgcgtcaaccattctttgaattagga
gacatgactgatgagatggtcgattatttgacatcagacgatggacgcaaagtattttct
gcatgggaatcagcttacacagcgctaccagaatcagcaaccgcagaagattatatgaat
accattcgttcgattcaaaacacacttgacatcaagggtcgcaatttatggaacccaatt
cgtattgcgacaacgcatgaaattcaaggtcctaacctaccagaaatgttagttgttatg
gataagaaaacaattttgagtacaatggctgatattaaagcgacatatttgaattaa

DBGET integrated database retrieval system