KEGG   Leuconostoc gelidum: C269_01345Help
Entry
C269_01345        CDS       T02322                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lge  Leuconostoc gelidum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    C269_01345
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C269_01345
  Lipid metabolism
   00071 Fatty acid degradation
    C269_01345
  Amino acid metabolism
   00350 Tyrosine metabolism
    C269_01345
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C269_01345
   00626 Naphthalene degradation
    C269_01345
Enzymes [BR:lge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     C269_01345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284589..285644
Genome map
AA seq 351 aa AA seqDB search
MKAALVRETPDGYVDLINDWTPKPLTFGEALVDMEYVGLCHTDLHVAGADFGNPNEMGQR
NGQFRRVIGHEGVGRVSKLAEGAGDYLKIGDRVSVAWFYDACGVCDYCVSGNETFCRKVR
NSGYTVDGAMSQQTVVNAKYAVKVPEGLDPVEATSITCAGVTMYKSLKVGETKPGQWVSV
HGAGGLGNLAVQYAHNVFGAHVAVIDGNDDKLAAAKANGAEVLINRKKVADVAAEVQKAT
GGVHNAQVTAVNAAAFDQAVSSLRPMGKLVAVALPQGDMALNIAKTVLDGIEVRGSLVGT
RADLKEAFQFGAEGKVKPIVEKVNFNDMNEVIDEMKAGSITGRKVFDLTAL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacttgtacgtgaaacaccagatggatacgttgatttaattaatgattgg
acaccgaaaccattaacatttggtgaagctttagtagatatggaatatgttggtttatgt
cacacagacttgcatgttgccggggctgattttggcaatccaaatgaaatggggcaacgt
aatggtcagttccgtcgtgttattggtcatgaaggtgttggacgtgtatcaaagcttgcg
gaaggtgcgggcgattatttgaaaattggtgatcgcgtgtcagttgcttggttctatgat
gcctgtggcgtatgtgattattgtgtttcaggaaatgaaacattttgtcgtaaagtccgt
aattcaggttatacagttgatggtgcaatgtcacagcaaactgttgtcaatgcaaagtat
gctgttaaagtaccagaaggcttagatccagtggaagccacatcaattacgtgtgcaggt
gtgactatgtataagtcacttaaagttggtgaaacaaagcccggacaatgggtttccgtt
catggtgctggtggtttaggtaatttagctgtgcagtatgctcataatgttttcggtgca
catgttgctgttattgatggcaatgatgacaagcttgctgctgccaaggcaaacggtgct
gaggttttgattaatcgtaagaaagtagccgatgttgctgctgaagtgcaaaaggcaact
ggtggtgtgcataacgcacaagtaacggccgttaatgcagcagcatttgaccaagctgtc
agctcattacgcccaatgggtaaattggtcgcagttgccttaccacaaggtgatatggct
ctaaacattgcaaaaactgtattagatggtatcgaagtccgcggttcattggttggtaca
cgtgcggatttgaaggaagcctttcaatttggtgccgaaggtaaagttaagcccattgta
gaaaaagttaactttaacgatatgaacgaagtaattgatgagatgaaagccggaagtatt
acaggtcgtaaagtatttgatctcacagcattataa

DBGET integrated database retrieval system