KEGG   Leuconostoc gelidum: C269_01740Help
Entry
C269_01740        CDS       T02322                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lge  Leuconostoc gelidum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    C269_01740 (recR)
DNA repair and recombination proteins [BR:lge03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      C269_01740 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364398..365003
Genome map
AA seq 201 aa AA seqDB search
MDYPEPIAKLIDSYTKLPGIGSKTATRLAFYTLGMDEKDVLDFSKSLVSAKKDLTFCSVC
GNITENSINPCVICRDATRDQSTVFVVENSRDVMAMENTRDYHGLYHILNGVISPSAGTG
PEDINLPSLIRRLSEHQEIDEVIVGTNVTAEGEATAMYLARLLKPAGIKVTRLAHGLAVG
SDIDYADQLTLIKAVQGRTEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggattatccagaacctattgcaaaattaatagatagttatacaaaattacctggtatt
ggttcaaaaactgcgacacgtttggctttttatacgcttggcatggacgaaaaagatgta
ctagatttttcaaaatcactcgtttctgccaaaaaagatctgacattttgttcggtatgt
ggtaatataacggaaaatagtattaatccttgtgtgatatgtcgagatgctacgcgtgat
caatctacagtgtttgttgtcgaaaattctcgtgatgtcatggctatggagaacacgagg
gactatcatggactttaccatattttgaacggtgtaatctcacctagtgcgggaacaggg
ccagaagatattaatttacctagtttaattcgacgtttatcagaacatcaagaaattgat
gaggttattgttggtaccaatgttaccgctgaaggtgaagcaacagccatgtatcttgca
aggctactcaagcctgcaggaattaaggtgacacgtttagcacatggtttggcagttggg
tcagatatcgattatgcagatcagttaacacttattaaagccgtacaaggacgaacagaa
ttatga

DBGET integrated database retrieval system