KEGG   Leuconostoc gelidum: C269_01740Help
Entry
C269_01740        CDS       T02322                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lge  Leuconostoc gelidum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lge03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364398..365003
Genome map
AA seq 201 aa AA seqDB search
MDYPEPIAKLIDSYTKLPGIGSKTATRLAFYTLGMDEKDVLDFSKSLVSAKKDLTFCSVC
GNITENSINPCVICRDATRDQSTVFVVENSRDVMAMENTRDYHGLYHILNGVISPSAGTG
PEDINLPSLIRRLSEHQEIDEVIVGTNVTAEGEATAMYLARLLKPAGIKVTRLAHGLAVG
SDIDYADQLTLIKAVQGRTEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggattatccagaacctattgcaaaattaatagatagttatacaaaattacctggtatt
ggttcaaaaactgcgacacgtttggctttttatacgcttggcatggacgaaaaagatgta
ctagatttttcaaaatcactcgtttctgccaaaaaagatctgacattttgttcggtatgt
ggtaatataacggaaaatagtattaatccttgtgtgatatgtcgagatgctacgcgtgat
caatctacagtgtttgttgtcgaaaattctcgtgatgtcatggctatggagaacacgagg
gactatcatggactttaccatattttgaacggtgtaatctcacctagtgcgggaacaggg
ccagaagatattaatttacctagtttaattcgacgtttatcagaacatcaagaaattgat
gaggttattgttggtaccaatgttaccgctgaaggtgaagcaacagccatgtatcttgca
aggctactcaagcctgcaggaattaaggtgacacgtttagcacatggtttggcagttggg
tcagatatcgattatgcagatcagttaacacttattaaagccgtacaaggacgaacagaa
ttatga

DBGET integrated database retrieval system