KEGG   Leuconostoc gelidum: C269_03190Help
Entry
C269_03190        CDS       T02322                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lge  Leuconostoc gelidum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C269_03190
Enzymes [BR:lge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     C269_03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
666587..668038
Genome map
AA seq 483 aa AA seqDB search
MKKLTNEAMLITYADSLGKNLKELNQVLSNELNGVVGGVHVLPFFPSTGDRGFAPEQYET
VDPKFGDWSDVDKLADKYYLMFDFMLNHISPQSKYFQDFLEKKEASEYYDMFLKYSDFWP
ENRPTDADIDLIYKRKDKAPFAPVTFADGTTDQVWNTFGDQQMDLDVTKEVTKKFIKDSL
VNLAHHGASVIRLDAFAYAIKKLDTNDFFVEPEIWAILDEVREILAAEGSEVLPEIHEHY
KIVRKITEHDMYSYDFALPLITLYSLYSGKTERIADWLRQSPMKQFTTLDTHDGIGVVDA
KDLLTQEETDFTTEEMYKVGANVKKIFSSAAYNNLDIYQINTTYYSALGNDDAAYLLARA
AQIFAPGIPQIYYVGLLAGENDIELLENSKEGRNINRHYYDLAEIAETTKRPVVSNLFDL
LRFRNTSAAFDLDGSIDVVNDGENELTVSRTSADGKTTAVLDANFATKSFTVTENGKEIF
TTK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactaacaaatgaagcgatgttgattacatacgctgattcacttggaaaaaac
ttgaaagaattgaatcaagtactatctaatgaacttaatggtgttgtaggcggcgtgcat
gtcctaccatttttcccatcaacaggggatcgtggttttgcgcctgaacagtatgagaca
gttgatcctaaatttggtgattggtcagatgttgataagttggcagacaaatactacttg
atgtttgactttatgttgaatcatatttcacctcaatcaaagtatttccaagattttttg
gaaaagaaagaggcgtcagaatattatgatatgttcctgaagtattctgatttttggcca
gaaaatcgaccaacagatgccgatattgatttgatatataagcgtaaggataaagcacca
tttgcgcctgttacctttgctgatggcacaactgaccaagtttggaacacatttggtgat
caacaaatggatttggatgttacaaaagaagtaacaaaaaaattcattaaagattcactt
gttaatttggcacatcatggtgcatcagttattcgtttagatgcctttgcttatgcaatt
aagaagctagatacaaatgactttttcgttgaacctgaaatttgggctattttagatgaa
gttcgtgaaatattggcagcagaaggatcagaagtattacctgaaatccatgaacattac
aaaattgtacgtaagattactgaacatgacatgtattcatacgattttgcattgccactg
attacattatattcattatactcaggtaagacagaacgaattgcggattggctgcgtcaa
agtccaatgaaacaattcacaacattggatacacatgatggtattggtgttgttgatgct
aaggatttgttgacacaagaagaaactgacttcacaactgaagaaatgtataaagttggt
gccaatgtcaaaaagattttctcttcagcggcatataataatttggacatctatcaaata
aacacaacttattattcagcattaggtaatgatgatgctgcctacttattggctcgtgca
gcacaaatatttgcacctggtattccacaaatttattacgttggtttgcttgctggtgaa
aatgatattgaacttttggaaaattcaaaagaaggtcgtaacattaaccgtcattattat
gacttggctgaaattgctgaaacaacaaagcgaccagttgtttcaaacttgtttgactta
ttacgtttccgtaatacaagtgcagcctttgatttagatggttcaattgatgtagttaat
gatggcgaaaatgaattgacagtatcacgtacatctgcagatggcaaaacaactgctgtt
ttggatgctaactttgcaacaaagagctttactgtaactgaaaatggtaaagaaatattt
acgacaaagtaa

DBGET integrated database retrieval system