KEGG   Leuconostoc gelidum: C269_03290Help
Entry
C269_03290        CDS       T02322                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lge  Leuconostoc gelidum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    C269_03290 (ruvA)
Enzymes [BR:lge01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     C269_03290 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
687611..688201
Genome map
AA seq 196 aa AA seqDB search
MYEYINGLITNIYPAYLVICDRSGVGYKLFVANPYRFEQNVESHVYVEQIVRENEITMYG
FIDENEKILFNKLLNVSGIGPKSALAILASDDAVGLVNAVANDDATYLTQFPGVGKKTAQ
QIVLDLKGKLDDLAASVGMTTPVSQSNSNQALSDALEALNSLGYSTKEIAKLEKTLAAKH
DTTDGYIRSALKLLVN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaatatattaatggtttaattacgaatatttacccagcttatttggtcatttgt
gaccgcagtggtgtggggtacaaactgtttgtggctaatccatatcgttttgaacaaaat
gtggaatcacatgtttacgtggaacaaatcgtgcgtgaaaatgaaatcacgatgtatggt
tttattgatgaaaatgaaaaaatattgttcaataaactattaaatgtttccggtattggg
cccaaaagtgctttggccattttagctagtgatgatgcagttggcttagttaatgctgtt
gcaaatgatgatgcaacttacctaacacagtttccaggtgtcggtaaaaaaacggcgcaa
caaattgttttggatttaaaagggaaattggatgatttggctgcctccgttggtatgaca
acgccagtttcgcagtcaaattcaaaccaggcattatctgatgctctagaagctttaaat
tcattaggctacagcactaaagaaattgctaagctggaaaaaactttagcagccaaacac
gatacaacagatggttatatccgttcagcactaaaattgttagtcaattaa

DBGET integrated database retrieval system