KEGG   Leuconostoc gelidum: C269_03430Help
Entry
C269_03430        CDS       T02322                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lge  Leuconostoc gelidum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    C269_03430
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    C269_03430
Enzymes [BR:lge01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     C269_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
717728..718321
Genome map
AA seq 197 aa AA seqDB search
MTEEFFEKKLAAQPIAAIPGMIAFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFKEDKL
QNNVSLSRKGVLRGLHAEPWDKYISVADNGRVLGSWVDLREGDSFGHVYQTVIDASKGIY
VPRGVANGFQVLSETVSYSYLVNDYWALDLKPKYAFVNYADPALGIEWHDVENAEVSEAD
KNHPLLKDVVPLTKEQL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaattttttgagaaaaaattggcagcacaaccaattgcagctattccgggg
atgattgcctttgatattcctgttcacggtgataatcgtggttggtttaaggaaaacttc
caaaaagaaaagatgttaccccttggttttccagagtctttctttaaagaggataagtta
caaaacaacgtgtccttatcacgaaagggtgtactacgtggcctgcatgctgaaccatgg
gataagtacatttcagtggctgataacggtcgtgtgttgggctcttgggttgacctacgc
gaaggagattcatttggacatgtctaccaaacggttattgatgctagtaagggcatttat
gtaccacgtggtgttgctaatggattccaagtattgagtgaaacagtatcgtactcgtac
ttggtcaatgactactgggcactagatttaaagccaaagtatgcctttgtgaattacgca
gatcctgctttgggtattgaatggcatgatgttgaaaatgctgaagtaagtgaagcagac
aaaaaccatcctttgctaaaagatgtcgtgccactaacaaaagagcaattgtaa

DBGET integrated database retrieval system