KEGG   Leuconostoc gelidum: C269_03545Help
Entry
C269_03545        CDS       T02322                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lge  Leuconostoc gelidum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lge01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lge00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
742596..743840
Genome map
AA seq 414 aa AA seqDB search
MDNDELVLQDLVRINTTGKNEVAIAKYLKKLFDEHGITNEIIEFDDGRAGLIAEIGNGHG
PILAFDGHEDTVALGDKTRWQTDPLSGIKIGDKIFGRGITDMKSGLAAGVLAMIRLKRNE
QLLNGTFKLYATVGEETGELGAKQMVEAGLANHIDALLIGEPSGIQLDYIKSLPVEQLLP
GIVMAENIHDISEKNKTTEQHFLEIAHKGAISYRITSQGITAHSSMPELGVNAIDALLTF
YNKQQELFNDISKIQNKLLGKTTPVVTQIDGGEQPNTVPGSATMGVFVRTIPEVPHEKIV
TEVKKIINEINASGKAVLSLTINFENQPVYSNPNGRLSQITKKIGEKLIHQSLPFIGVSG
GTDASQFIKANPNMEVVIFGPGNITAHQVDEFVDAGMYHSFIDIYESVVHQYLK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggataatgatgaattagttttgcaggatctcgttcgaattaatactactggaaaaaat
gaagtggcgattgctaaatatttgaaaaagttatttgatgagcatggtattaccaatgaa
ataattgaattcgacgatggacgagcaggtctcattgctgaaattggcaatggacatggc
ccaattttagcttttgatgggcatgaagatacagttgctttgggagataaaacgcgttgg
caaacagacccattaagtggcattaaaattggtgacaaaatatttggcagaggaatcact
gacatgaaatcaggtttagcggccggggtgttagcgatgattcgattaaagagaaacgaa
cagttgttaaatggtacgtttaaattatatgcaactgttggtgaagaaactggtgaatta
ggtgccaagcaaatggttgaagctgggttggctaatcatattgatgcattattaattggt
gaacctagtggcatacagctagactatattaaatcattaccggtagaacaattgttacct
ggcattgtaatggcagaaaacatacatgacatcagtgagaaaaacaaaacaactgagcaa
cattttttagaaattgcacacaaaggtgcaatttcttatcgtattacgagtcaaggtatt
acggcacatagttcaatgcctgaacttggcgtcaatgccattgacgctttgttaacattt
tataataagcaacaagaactatttaacgatatctctaaaattcaaaacaaattactgggc
aagacgacaccggttgtcacacaaatagatggtggggaacaacccaataccgttcctggt
agtgcaacaatgggcgtctttgttaggacaatcccagaggtaccacatgaaaaaatagta
acagaggttaaaaaaatcattaatgaaataaatgctagtgggaaagctgtactaagtttg
acgattaattttgaaaatcagcctgtttactctaatccgaatggtagattaagccaaatt
acaaaaaaaattggcgaaaagttaatacaccaatcattaccatttattggtgtttctggc
ggtactgatgcttcacaatttattaaggctaatccaaatatggaagttgttatttttgga
ccaggaaacattacagcacaccaagttgatgaatttgttgatgccggtatgtatcattca
tttatagatatttatgaatcagtggtacatcaatatttgaaataa

DBGET integrated database retrieval system